Anti-ND6 antibody (ab214224)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-ND6 antibody
See all ND6 primary antibodies -
Description
Rabbit polyclonal to ND6 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Rat, Human
Predicted to work with: Mouse
-
Immunogen
Synthetic peptide within Human ND6 aa 47-97 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:GGGYMGLMVFLIYLGGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGL A
Database link: P03923 -
Positive control
- Human breast cancer and rat brain tissues.
-
General notes
This product was previously labelled as NADH Dehydrogenase subunit 6
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol, 1% BSA -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab214224 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
NADH Dehydrogenase subunit 6 (MTND6) is 1 of the 7 mitochondrial DNA (mtDNA) encoded subunits (MTND1, MTND2, MTND3, MTND4L, MTND4, MTND5, MTND6) included among the approximately 41 polypeptides of respiratory Complex I. Complex I accepts electrons from NADH, transfers them to ubiquinone (Coenzyme Q10), and uses the energy released to pump protons across the mitochondria inner membrane. MTND6 has been proposed to be a component of the iron-protein fragment. The predicted polypeptide has a molecular weight of 18.6 kD. Its apparent MW on SDS-polyacrylamide gels (PAGE) using Tris-glycine buffer is 16.7 kD, and the apparent MW on urea-phosphate gels is also close to the predicted molecular weight. -
Cellular localization
Mitochondrion membrane; Multi-pass membrane protein. -
Database links
- Entrez Gene: 4541 Human
- Entrez Gene: 17722 Mouse
- Entrez Gene: 26203 Rat
- Omim: 516006 Human
- SwissProt: P03923 Human
- SwissProt: P03925 Mouse
- SwissProt: P03926 Rat
-
Alternative names
- Mitochondrially encoded NADH dehydrogenase 6 antibody
- MT ND6 antibody
- mtND6 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ND6 antibody (ab214224)Immunohistochemical analysis of formalin-fixed, paraffin-embedded human breast cancer tissue labeling ND6 with ab214224 at 1/100 dilution, followed by secondary antibody detection and DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ND6 antibody (ab214224)Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling ND6 with ab214224 at 1/400 dilution, followed by secondary antibody detection and DAB staining.
Protocols
Datasheets and documents
References
ab214224 has not yet been referenced specifically in any publications.
