Overview

  • Product name

  • Description

    Rabbit polyclonal to ND6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human ND6 aa 47-97 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    GGGYMGLMVFLIYLGGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGL A


    Database link: P03923

  • Positive control

    • Human breast cancer and rat brain tissues.
  • General notes

     This product was previously labelled as NADH Dehydrogenase subunit 6

     

Properties

Applications

Our Abpromise guarantee covers the use of ab214224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    NADH Dehydrogenase subunit 6 (MTND6) is 1 of the 7 mitochondrial DNA (mtDNA) encoded subunits (MTND1, MTND2, MTND3, MTND4L, MTND4, MTND5, MTND6) included among the approximately 41 polypeptides of respiratory Complex I. Complex I accepts electrons from NADH, transfers them to ubiquinone (Coenzyme Q10), and uses the energy released to pump protons across the mitochondria inner membrane. MTND6 has been proposed to be a component of the iron-protein fragment. The predicted polypeptide has a molecular weight of 18.6 kD. Its apparent MW on SDS-polyacrylamide gels (PAGE) using Tris-glycine buffer is 16.7 kD, and the apparent MW on urea-phosphate gels is also close to the predicted molecular weight.
  • Cellular localization

    Mitochondrion membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • Mitochondrially encoded NADH dehydrogenase 6 antibody
    • MT ND6 antibody
    • mtND6 antibody
    • NADH dehydrogenase subunit 6 (complex I) antibody
    • NADH ubiquinone oxidoreductase chain 6 antibody
    • NADH Ubiquinone Oxidoreductase subunit ND6 antibody
    • NADH6 antibody
    • ND6 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human breast cancer tissue labeling ND6 with ab214224 at 1/100 dilution, followed by secondary antibody detection and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling ND6 with ab214224 at 1/400 dilution, followed by secondary antibody detection and DAB staining.

References

ab214224 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

Application
Western blot
Sample
Mouse Cell lysate - whole cell (mouse fibroblast)
Gel Running Conditions
Reduced Denaturing (7-15% SDS gel)
Loading amount
20 µg
Specification
mouse fibroblast
Blocking step
Milk as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Janice Deng

Verified customer

Submitted Jun 01 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up