Overview

  • Product name

  • Description

    Rabbit polyclonal to ND6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Pig, Chimpanzee
  • Immunogen

    Synthetic peptide corresponding to Human ND6 aa 110-159 (internal sequence).
    Sequence:

    DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT


    Database link: NP_536854

  • Positive control

    • Human fetal lung lysate.
  • General notes

     This product was previously labelled as NADH Dehydrogenase subunit 6

     

Properties

Applications

Our Abpromise guarantee covers the use of ab81212 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 1 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 19 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    NADH Dehydrogenase subunit 6 (MTND6) is 1 of the 7 mitochondrial DNA (mtDNA) encoded subunits (MTND1, MTND2, MTND3, MTND4L, MTND4, MTND5, MTND6) included among the approximately 41 polypeptides of respiratory Complex I. Complex I accepts electrons from NADH, transfers them to ubiquinone (Coenzyme Q10), and uses the energy released to pump protons across the mitochondria inner membrane. MTND6 has been proposed to be a component of the iron-protein fragment. The predicted polypeptide has a molecular weight of 18.6 kD. Its apparent MW on SDS-polyacrylamide gels (PAGE) using Tris-glycine buffer is 16.7 kD, and the apparent MW on urea-phosphate gels is also close to the predicted molecular weight.
  • Cellular localization

    Mitochondrion membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • Mitochondrially encoded NADH dehydrogenase 6 antibody
    • MT ND6 antibody
    • mtND6 antibody
    • NADH dehydrogenase subunit 6 (complex I) antibody
    • NADH ubiquinone oxidoreductase chain 6 antibody
    • NADH Ubiquinone Oxidoreductase subunit ND6 antibody
    • NADH6 antibody
    • ND6 antibody
    see all

Images

  • Anti-ND6 antibody (ab81212) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal lung lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 19 kDa
    Observed band size: 24 kDa
    why is the actual band size different from the predicted?



    Gel concentration: 12%
  • IHC image of ab81212 staining in Human breast cancer formalin fixed paraffin embedded tissue section, performed on a Leica BondTM system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab81212, 1µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

References

This product has been referenced in:

  • Zhang Q  et al. Deletion of Mtu1 (Trmu) in zebrafish revealed the essential role of tRNA modification in mitochondrial biogenesis and hearing function. Nucleic Acids Res 46:10930-10945 (2018). Read more (PubMed: 30137487) »
  • Zhu G  et al. Acute effect of lactic acid on tumor-endothelial cell metabolic coupling in the tumor microenvironment. Oncol Lett 12:3478-3484 (2016). WB ; Human . Read more (PubMed: 27900024) »
See all 6 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

1-4 of 4 Abreviews

Application
Western blot
Loading amount
30 µg
Gel Running Conditions
Reduced Denaturing
Sample
Human Cell lysate - whole cell (macrophage)
Specification
macrophage
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Dec 22 2014

Application
Western blot
Loading amount
100 µg
Gel Running Conditions
Reduced Denaturing (12)
Sample
Human Cell lysate - whole cell (MDM)
Specification
MDM
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Nov 27 2013

Application
Western blot
Sample
Fruit fly (Drosophila melanogaster) Tissue lysate - whole (Whole larval extract)
Loading amount
100 µg
Specification
Whole larval extract
Gel Running Conditions
Reduced Denaturing (12%)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 21°C

Abcam user community

Verified customer

Submitted Nov 05 2012

Application
Western blot
Sample
Human Cell lysate - other (Mitochondrial fractions of HeLa WT and HeLa rho-0)
Loading amount
26 µg
Specification
Mitochondrial fractions of HeLa WT and HeLa rho-0
Gel Running Conditions
Reduced Denaturing (Reduced Denaturing (Reduced Denaturing (4-15%))
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C

Abcam user community

Verified customer

Submitted Aug 21 2012

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up