Overview

  • Product name

  • Description

    Rabbit polyclonal to NDC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NDC1 aa 437-508.
    Sequence:

    KLSTPDVVSPFGTPFGSSVMNRMAGIFDVNTCYGSPQSPQLIRRGPRLWT SASDQQMTEFSNPSPSTSISAE


    Database link: Q9BTX1

  • Positive control

    • ICC/IF: RH-30 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    NDC1 is a component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. NDC1 is required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane. NDC1 colocalizes with p62 (NUP62) on the nuclear envelope at the nuclear rim. The protein has 6 transmembrane domains and several putative phosphorylation sites.
  • Cellular localization

    Nucleus; nuclear pore complex; multipass membrane protein
  • Database links

  • Alternative names

    • FLJ10407 antibody
    • FLJ12556 antibody
    • FLJ34120 antibody
    • hNDC1 antibody
    • NDC1 transmembrane nucleoporin antibody
    • NET3 antibody
    • Nuclear division cycle 1 homolog antibody
    • TMEM48 antibody
    • Transmembrane protein 48 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized RH-30 cells stained for NDC1 (green) using ab221753 at 4 µg/ml in ICC/IF. 

References

ab221753 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up