Overview

  • Product name

    Anti-NDE1 antibody - N-terminal
    See all NDE1 primary antibodies
  • Description

    Rabbit polyclonal to NDE1 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human NDE1 aa 1-110 (N terminal).
    Sequence:

    MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAEL ETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDL AQTKAIKDQL


    Database link: Q9NXR1

  • Positive control

    • IHC-P: Human colon cancer and adrenal gland tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230003 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Required for centrosome duplication. Essential for the development of the cerebral cortex. May regulate the production of neurons by controlling the orientation of the mitotic spindle during division of cortical neuronal progenitors of the proliferative ventricular zone of the brain. Orientation of the division plane perpendicular to the layers of the cortex gives rise to two proliferative neuronal progenitors whereas parallel orientation of the division plane yields one proliferative neuronal progenitor and a post-mitotic neuron. A premature shift towards a neuronal fate within the progenitor population may result in an overall reduction in the final number of neurons and an increase in the number of neurons in the deeper layers of the cortex (By similarity). Required for formation and function of the mitotic spindle.
  • Sequence similarities

    Belongs to the nudE family.
  • Post-translational
    modifications

    Phosphorylated in mitosis.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome. Chromosome > centromere > kinetochore. Cytoplasm > cytoskeleton > spindle. Cleavage furrow. Localizes to the interphase centrosome and to the mitotic spindle. Concentrates at the plus ends of microtubules coincident with kinetochores in metaphase and anaphase in a CENPF-dependent manner. Also localizes to the cleavage furrow during cytokinesis.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ20101 antibody
    • HOM TES 87 antibody
    • LIS1 interacting protein NUDE1 rat homolog antibody
    • LIS1 interacting protein NUDE1 antibody
    • LIS4 antibody
    • NDE 1 antibody
    • NDE1 antibody
    • NDE1_HUMAN antibody
    • Nuclear distribution gene E homolog 1 antibody
    • Nuclear distribution protein nudE homolog 1 antibody
    • NUDE 1 antibody
    • NudE antibody
    • NudE nuclear distribution gene E homolog 1 (A. nidulans) antibody
    • NudE nuclear distribution gene E homolog 1 antibody
    • NUDE1 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for NDE1 using ab230003 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for NDE1 using ab230003 at 1/100 dilution in immunohistochemical analysis.

References

ab230003 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230003.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up