Overview

  • Product name

    Anti-NDNF antibody - N-terminal
    See all NDNF primary antibodies
  • Description

    Rabbit polyclonal to NDNF - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Synthetic peptide within Human NDNF aa 86-135 (N terminal). The exact sequence is proprietary. NP_078850.3
    Sequence:

    LEWKLSLQELPEDRSGEGSGDLEPLEQQKQQIINEEGTELFSYKGNDVEY


    Database link: Q8TB73

  • Positive control

    • Jurkat whole cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab177913 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 65 kDa.

Target

  • Function

    Promotes matrix assembly and cell adhesiveness (By similarity). Promotes neuron migration, growth and survival as well as neurite outgrowth.
  • Sequence similarities

    Contains 2 fibronectin type-III domains.
  • Post-translational
    modifications

    O-glycosylated; contains heparan sulfate and chondroitin sulfate.
    N-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C4orf31 antibody
    • Fibronectin type III domain containing protein C4orf31 antibody
    • NDNF antibody
    • NDNF_HUMAN antibody
    • Neuron-derived neurotrophic factor antibody
    • PRO6487 antibody
    • Protein NDNF antibody
    • UNQ2748 antibody
    see all

Images

  • Anti-NDNF antibody - N-terminal (ab177913) at 1 µg/ml + Jurkat whole cell lysate at 10 µg

    Predicted band size: 65 kDa

References

ab177913 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177913.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up