Anti-NDP52 antibody [OTI4H5] (ab124372)
Key features and details
- Mouse monoclonal [OTI4H5] to NDP52
- Suitable for: Flow Cyt (Intra), WB, ICC/IF
- Reacts with: Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-NDP52 antibody [OTI4H5]
See all NDP52 primary antibodies -
Description
Mouse monoclonal [OTI4H5] to NDP52 -
Host species
Mouse -
Tested applications
Suitable for: Flow Cyt (Intra), WB, ICC/IFmore details -
Species reactivity
Reacts with: Human, African green monkey -
Immunogen
Recombinant full length protein corresponding to Human NDP52 aa 1-446. Produced in HEK-293T cells (NP_005822).
Sequence:MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIP RRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPK DDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNK ELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKE QKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQG DQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQ QELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMG LDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPIC KADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL
Database link: Q13137 -
Positive control
- WB: HEK-293T cell lysate transfected with pCMV6-ENTRY NDP52 cDNA; HeLa, A549, COS-7, Jurkat and MCF7 cell extracts; Human testis, omentum, uterus, breast, brain, liver, ovary, thyroid gland and colon lysate. ICC/IF: COS-7 cells transiently transfected by NDP52 cDNA. Flow Cyt (Intra): HeLa and Jurkat cells; HEK-293T cells transfected with pCMV6-ENTRY NDP52.
-
General notes
Clone OTI4H5 (formerly 4H5).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant. -
Clonality
Monoclonal -
Clone number
OTI4H5 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab124372 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
Flow Cyt (Intra) |
1/100.
|
|
WB |
1/500 - 1/2000. Predicted molecular weight: 52 kDa.
|
|
ICC/IF |
1/100.
|
Notes |
---|
Flow Cyt (Intra)
1/100. |
WB
1/500 - 1/2000. Predicted molecular weight: 52 kDa. |
ICC/IF
1/100. |
Target
-
Function
May play a role in ruffle formation and actin cytoskeleton organization. Seems to negatively regulate constitutive secretion. -
Tissue specificity
Expressed in all tissues tested with highest expression in skeletal muscle and lowest in brain. -
Cellular localization
Cytoplasm > perinuclear region. Golgi apparatus. Cytoplasm > cytoskeleton. According to PubMed:7540613, localizes to nuclear dots. According to PubMed:9230084 and PubMed:12869526, it is not a nuclear dot-associated protein but localizes predominantly in the cytoplasm with a coarse-grained distribution preferentially close to the nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 10241 Human
- Omim: 604587 Human
- SwissProt: Q13137 Human
- Unigene: 514920 Human
-
Alternative names
- Antigen nuclear dot 52 kDa protein antibody
- CACO2_HUMAN antibody
- Calcium binding and coiled coil domain 2 antibody
see all
Images
-
COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY NDP52, labeling NDP52 using ab124372 at dilution 1/100 dilution in ICC/IF.
-
All lanes : Anti-NDP52 antibody [OTI4H5] (ab124372) at 1/500 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY NDP52 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 52 kDa -
All lanes : Anti-NDP52 antibody [OTI4H5] (ab124372) at 1/500 dilution
Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
Lane 3 : SVT2 cell extract
Lane 4 : A549 (human lung carcinoma cell line) cell extract
Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) cell extract
Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
Lane 7 : MDCK (Canine kidney cell line) cell extract
Lane 8 : PC-12 (Rat adrenal gland pheochromocytoma cell line) cell extract
Lane 9 : MCF7 (Human breast adenocarcinoma cell line) cell extract
Lysates/proteins at 35 µg per lane.
Predicted band size: 52 kDa -
Flow cytometric analysis of HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with either NDP52 overexpress plasmid (Red) or empty vector control plasmid (Blue) labeling NDP52 with ab124372 at 1/100 dilution.
-
All lanes : Anti-NDP52 antibody [OTI4H5] (ab124372) at 1/500 dilution
Lane 1 : Human testis extract
Lane 2 : Human omentum extract
Lane 3 : Human uterus extract
Lane 4 : Human breast extract
Lane 5 : Human brain extract
Lane 6 : Human liver extract
Lane 7 : Human ovary extract
Lane 8 : Human thyroid gland extract
Lane 9 : Human colon extract
Lysates/proteins at 10 µg per lane.
Predicted band size: 52 kDa -
Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling NDP52 using ab124372 at 1/100 dilution (Red), compared to a nonspecific negative control antibody (Blue).
-
Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cells labeling NDP52 using ab124372 at a dilution of 1/100 (Red), compared to a nonspecific negative control antibody (Blue).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab124372 has been referenced in 1 publication.
- Fili N et al. NDP52 activates nuclear myosin VI to enhance RNA polymerase II transcription. Nat Commun 8:1871 (2017). PubMed: 29187741