Overview

  • Product name

    Anti-NDST2 antibody - C-terminal
    See all NDST2 primary antibodies
  • Description

    Rabbit polyclonal to NDST2 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide within Human NDST2 aa 628-677 (C terminal). The exact sequence is proprietary.
    Sequence:

    AVTSSFPSPSTFEEIQFFNSPNYHKGIDWYMDFFPVPSNASTDFLFEKSA


    Database link: P52849

  • Positive control

    • HepG2 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab182097 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 101 kDa.

Target

  • Function

    Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a role in determining the extent and pattern of sulfation of heparan sulfate.
  • Pathway

    Glycan metabolism; heparan sulfate biosynthesis.
    Glycan metabolism; heparin biosynthesis.
  • Sequence similarities

    Belongs to the sulfotransferase 1 family. NDST subfamily.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • [Heparan sulfate]-glucosamine N-sulfotransferase antibody
    • bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2 antibody
    • Glucosaminyl N-deacetylase/N-sulfotransferase 2 antibody
    • glucosaminyl N-deacetylase/N-sulphotransferase 2 antibody
    • heparan glucosaminyl N-deacetylase/N-sulfotransferase 2 antibody
    • heparan N-sulfotransferase 2 antibody
    • heparan sulfate N-deacetylase/N-sulfotransferase 2 antibody
    • Heparan sulfate N-sulfotransferase 2 antibody
    • HSST2 antibody
    • mastocytoma N-deacetylase/N-sulfotransferase antibody
    • Mndns antibody
    • N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 2 antibody
    • N-heparan sulfate sulfotransferase 2 antibody
    • N-HSST 2 antibody
    • NDST-2 antibody
    • NDST2 antibody
    • NDST2_HUMAN antibody
    • NST2 antibody
    see all

Images

  • Anti-NDST2 antibody - C-terminal (ab182097) at 1 µg/ml + HepG2 whole cell lysate at 10 µg

    Predicted band size: 101 kDa

References

ab182097 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182097.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up