Overview

  • Product name

    Anti-NDUFA2 antibody
  • Description

    Rabbit polyclonal to NDUFA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Cynomolgus monkey, Gorilla, Orangutan
  • Immunogen

    Fusion protein corresponding to Human NDUFA2 aa 1-99. The identity of the protein fusion partner is GST.
    Sequence:

    MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPD LPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA


    Database link: O43678

  • Positive control

    • Raw264.7 cell lysate; Human thyroid cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab198196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/25 - 1/100.
WB 1/500 - 1/2000. Predicted molecular weight: 11 kDa.

Target

Images

  • Anti-NDUFA2 antibody (ab198196) at 1/300 dilution + Raw264.7 cell lysate at 40 µg

    Predicted band size: 11 kDa


    Exposure time: 5 seconds


    12% SDS-PAGE

  • Immunohistochemical analysis of paraffin-embedded Human thyroid cancer tissue labeling NDUFA2 with ab198196 at a 1/30 dilution.

References

ab198196 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198196.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up