Overview

  • Product name

  • Description

    Rabbit polyclonal to NDUFA6
  • Host species

    Rabbit
  • Specificity

    ab198242 detects endogenous level of total NDUFA6 protein.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Fusion protein corresponding to Human NDUFA6 aa 1-128. Full length fusion protein. The identity of the protein fusion partner is GST.
    Sequence:

    MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQF QLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQR THVMRFFHETEAPRPKDFLSKFYVGHDP


    Database link: BC002772

  • Positive control

    • Human kidney tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab198242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 15 kDa.

Target

  • Function

    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities

    Belongs to the complex I LYR family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B14 antibody
    • CI-B14 antibody
    • complex I B14 subunit antibody
    • Complex I-B14 antibody
    • LYR motif-containing protein 6 antibody
    • LYRM6 antibody
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 6 (14kD, B14) antibody
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 6, 14kDa antibody
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 antibody
    • NADH-ubiquinone oxidoreductase 1 alpha subcomplex, 6 antibody
    • NADH-ubiquinone oxidoreductase B14 subunit antibody
    • NADHB14 antibody
    • NDUA6_HUMAN antibody
    • NDUFA6 antibody
    see all

Images

  • Anti-NDUFA6 antibody (ab198242) at 1/250 dilution + Human kidney tissue lysate at 40 µg

    Predicted band size: 15 kDa



    10%SDS-PAGE

References

ab198242 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up