Overview

  • Product name

    Anti-NDUFA6 antibody (FITC)
    See all NDUFA6 primary antibodies
  • Description

    Rabbit polyclonal to NDUFA6 (FITC)
  • Host species

    Rabbit
  • Conjugation

    FITC. Ex: 493nm, Em: 528nm
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Chimpanzee, Rhesus monkey, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human NDUFA6 aa 27-154.
    Sequence:

    MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQF QLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQR THVMRFFHETEAPRPKDFLS KFYVGHDP


    Database link: P56556

Properties

Applications

Our Abpromise guarantee covers the use of ab193069 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/600. Predicted molecular weight: 18 kDa.

Target

  • Function

    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities

    Belongs to the complex I LYR family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B14 antibody
    • CI-B14 antibody
    • complex I B14 subunit antibody
    • Complex I-B14 antibody
    • LYR motif-containing protein 6 antibody
    • LYRM6 antibody
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 6 (14kD, B14) antibody
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 6, 14kDa antibody
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 antibody
    • NADH-ubiquinone oxidoreductase 1 alpha subcomplex, 6 antibody
    • NADH-ubiquinone oxidoreductase B14 subunit antibody
    • NADHB14 antibody
    • NDUA6_HUMAN antibody
    • NDUFA6 antibody
    see all

References

ab193069 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193069.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up