Overview

  • Product name
  • Description
    Rabbit polyclonal to NDUFA8
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
  • Immunogen

    Synthetic peptide within Mouse NDUFA8 aa 41-90 (internal sequence). The exact sequence is proprietary. (NP_080979.1)
    Sequence:

    KEFMLCRWEEKDPRRCLKEGKLVNGCALNFFRQIKSHCAEPFTEYWTCLD


    Database link: Q9DCJ5

  • Positive control
    • Mouse thymus lysate.

Applications

Our Abpromise guarantee covers the use of ab177342 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 20 kDa.

Target

  • Function
    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities
    Belongs to the complex I NDUFA8 subunit family.
    Contains 2 CHCH domains.
  • Domain
    Contains four C-X9-C motifs that are predicted to form a helix-coil-helix structure, permitting the formation of intramolecular disulfide bonds.
  • Post-translational
    modifications
    May contain intrachain disulfide bonds, as evidenced by its electrophoretic mobility under reducing vs non-reducing conditions.
  • Cellular localization
    Mitochondrion. Mitochondrion intermembrane space.
  • Information by UniProt
  • Database links
  • Alternative names
    • CI 19KD antibody
    • CI PGIV antibody
    • CI-19kD antibody
    • CI-PGIV antibody
    • Complex I 19k antibody
    • Complex I 19kD antibody
    • Complex I PGIV antibody
    • Complex I PGIV subunit antibody
    • Complex I-19kD antibody
    • Complex I-PGIV antibody
    • MGC793 antibody
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 8 (19kD PGIV) antibody
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 8 19kDa antibody
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 8 antibody
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 antibody
    • NADH ubiquinone oxidoreductase 19 kDa subunit antibody
    • NADH ubiquinone oxidoreductase PGIV subunit antibody
    • NADH-ubiquinone oxidoreductase 19 kDa subunit antibody
    • NDUA8_HUMAN antibody
    • NDUFA 8 antibody
    • NDUFA8 antibody
    • OTTHUMP00000022034 antibody
    • PGIV antibody
    see all

Images

  • Anti-NDUFA8 antibody (ab177342) at 1 µg/ml + Mouse thymus lysate at 10 µg

    Predicted band size: 20 kDa

References

ab177342 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177342.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up