Overview

  • Product name

  • Description

    Rabbit polyclonal to NDUFA9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NDUFA9 aa 1-270.
    Sequence:

    MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSS VSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDL GQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQ AIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAII VKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIV NAVKDPDANGKSFAFVGPSR


    Database link: Q16795

  • Positive control

    • IHC-P: Human liver cancer and small intestine tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229770 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities

    Belongs to the complex I NDUFA9 subunit family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • CI-39kD antibody
    • Complex I subunit NDUFA9 antibody
    • Complex I-39kD antibody
    • mitochondrial antibody
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 antibody
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial antibody
    • NADH Ubiquinone Oxidoreductase 1 alpha subcomplex 9 antibody
    • NADH-ubiquinone oxidoreductase 39 kDa subunit antibody
    • NDUA9_HUMAN antibody
    • NDUFA9 antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for NDUFA9 using ab229770 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for NDUFA9 using ab229770 at 1/100 dilution in immunohistochemical analysis.

References

ab229770 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229770.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up