Overview

  • Product name

  • Description

    Rabbit polyclonal to NDUFAB1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human NDUFAB1 aa 5-129. (Expressed in E. coli).
    Sequence:

    VLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVL AQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHF MKDLGLDSLDQVEIIMAMEDEFGFE


    Database link: O14561

  • Positive control

    • WB: Recombinant human NDUFAB1 protein; Mouse heart lysate. IHC-P: Human breast cancer, kidney and liver cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab232864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 17 kDa.

Target

  • Function

    Carrier of the growing fatty acid chain in fatty acid biosynthesis in mitochondria. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain.
  • Sequence similarities

    Contains 1 acyl carrier domain.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACP antibody
    • ACPM_HUMAN antibody
    • Acyl carrier protein antibody
    • Acyl carrier protein mitochondrial antibody
    • CI SDAP antibody
    • CI-SDAP antibody
    • FASN 2A antibody
    • FASN2A antibody
    • MGC65095 antibody
    • Mitochondrial acyl carrier protein antibody
    • mitochondrial antibody
    • NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1 8kDa antibody
    • NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1 antibody
    • NADH ubiquinone oxidoreductase 9.6 kDa subunit antibody
    • NADH ubiquinone oxidoreductase SDAP subunit antibody
    • NADH-ubiquinone oxidoreductase 9.6 kDa subunit antibody
    • NDUFAB 1 antibody
    • ndufab1 antibody
    • SDAP antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for NDUFAB1 with ab232864 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human breast cancer tissue stained for NDUFAB1 with ab232864 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver cancer tissue stained for NDUFAB1 with ab232864 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-NDUFAB1 antibody (ab232864) at 2 µg/ml + Recombinant human NDUFAB1 protein

    Predicted band size: 17 kDa

  • Anti-NDUFAB1 antibody (ab232864) at 3 µg/ml + Mouse heart lysate

    Secondary
    HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 17 kDa

References

ab232864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up