Overview

  • Product name

  • Description

    Rabbit polyclonal to NDUFAF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human NDUFAF1 aa 25-327. Mature full length protein without the transit peptide.
    Sequence:

    YPFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQGDHQKEVALDITSS EEKPDVSFDKAIRDEAIYHFRLLKDEIVDHWRGPEGHPLHEVLLEQAKVV WQFRGKEDLDKWTVTSDKTIGGRSEVFLKMGKNNQSALLYGTLSSEAPQD GESTRSGYCAMISRIPRGAFERKMSYDWSQFNTLYLRVRGDGRPWMVNIK EDTDFFQRTNQMYSYFMFTRGGPYWQEVKIPFSKFFFSNRGRIRDVQHEL PLDKISSIGFTLADKVDGPFFLEIDFIGVFTDPAHTEEFAYENSPELNPR LFK


    Database link: Q9Y375

  • Positive control

    • IHC-P: Human colon cancer and adrenal gland tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238751 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I).
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the CIA30 family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • CGI 65 antibody
    • CGI65 antibody
    • CIA30 antibody
    • CIA30_HUMAN antibody
    • Complex I intermediate associated protein 30 antibody
    • Complex I intermediate associated protein 30 mitochondrial antibody
    • Complex I intermediate-associated protein 30, mitochondrial antibody
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex assembly factor 1 antibody
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 1 antibody
    • NADH:ubiquinone oxidoreductase complex assembly factor 1 antibody
    • NDUFAF 1 antibody
    • Ndufaf1 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for NDUFAF1 using ab238751 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for NDUFAF1 using ab238751 at 1/100 dilution in immunohistochemical analysis.

References

ab238751 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238751.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up