Overview

  • Product name

  • Description

    Rabbit polyclonal to NDUFS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide aa 350-400 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    KMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTA I


    Database link: O75306

  • Positive control

    • Mouse heart lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab216510 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/5000. Predicted molecular weight: 53 kDa.

Target

  • Function

    Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Involvement in disease

    Defects in NDUFS2 are a cause of mitochondrial complex I deficiency (MT-C1D) [MIM:252010]. A disorder of the mitochondrial respiratory chain that causes a wide range of clinical disorders, from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease.
  • Sequence similarities

    Belongs to the complex I 49 kDa subunit family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CI 49 antibody
    • CI 49kD antibody
    • CI-49kD antibody
    • Complex 1, mitochondrial respiratory chain, 49 KD subunit antibody
    • Complex I 49kD antibody
    • Complex I 49kDa subunit antibody
    • Complex I-49kD antibody
    • mitochondrial antibody
    • NADH dehydrogenase (ubiquinone) Fe S protein 2 49kDa antibody
    • NADH dehydrogenase (ubiquinone) Fe S protein 2, 49kDa (NADH coenzyme Q reductase) antibody
    • NADH dehydrogenase [ubiquinone] iron sulfur protein 2, mitochondrial antibody
    • NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 antibody
    • NADH ubiquinone oxidoreductase 49 kDa subunit antibody
    • NADH ubiquinone oxidoreductase NDUFS2 subunit antibody
    • NADH-ubiquinone oxidoreductase 49 kDa subunit antibody
    • NADH:ubiquinone oxidoreductase core subunit S2 antibody
    • Ndufs2 antibody
    • NDUS2_HUMAN antibody
    see all

Images

  • Anti-NDUFS2 antibody (ab216510) at 1/300 dilution (overnight at 4°C) + Mouse heart lysates

    Secondary
    Goat anti-rabbit IgG (H+L), HRP conjugated (90 min at 37°C) at 1/5000 dilution

    Predicted band size: 53 kDa

References

ab216510 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216510.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up