Overview

  • Product name

  • Description

    Rabbit polyclonal to Ndufs4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Ndufs4 aa 43-161.
    Sequence:

    AQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVN NTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNG WSYDIEERKVPKPKSKSYG


    Database link: O43181

  • Positive control

    • WB: U-87 MG, SH-SY5Y and A549 whole cell lysate. IHC-P: Human colon cancer and kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000.

Target

  • Function

    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Involvement in disease

    Defects in NDUFS4 are a cause of mitochondrial complex I deficiency (MT-C1D) [MIM:252010]. A disorder of the mitochondrial respiratory chain that causes a wide range of clinical disorders, from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease.
  • Sequence similarities

    Belongs to the complex I NDUFS4 subunit family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AQDQ antibody
    • CI 18 antibody
    • CI 18 kDa antibody
    • CI AQDQ antibody
    • CI-18 kDa antibody
    • CI-AQDQ antibody
    • Complex I 18 kDa antibody
    • Complex I AQDQ antibody
    • Complex I-18 kDa antibody
    • Complex I-AQDQ antibody
    • mitochondrial antibody
    • mitochondrial respiratory chain complex I (18 KD subunit) antibody
    • NADH coenzyme Q reductase antibody
    • NADH dehydrogenase (ubiquinone) Fe S protein 4 18kDa antibody
    • NADH dehydrogenase [ubiquinone] iron-sulfur protein 4 antibody
    • NADH dehydrogenase antibody
    • NADH ubiquinone oxidoreductase 18 kDa subunit antibody
    • NADH-ubiquinone oxidoreductase 18 kDa subunit antibody
    • NDUFS4 antibody
    • NDUS4_HUMAN antibody
    see all

Images

  • All lanes : Anti-Ndufs4 antibody (ab234983) at 1/500 dilution

    Lane 1 : U-87 MG (Human glioblastoma-astrocytoma epithelial cell line) whole cell lysate
    Lane 2 : SH-SY5Y (Human neuroblastoma cell line from bone marrow) whole cell lysate
    Lane 3 : A549 (Human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human colon cancer tissue stained for Ndufs4 with ab234983 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for Ndufs4 with ab234983 at 1/100 dilution in immunohistochemical analysis.

References

ab234983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up