Anti-NDUFS6 antibody (ab230464)
Key features and details
- Rabbit polyclonal to NDUFS6
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-NDUFS6 antibody
See all NDUFS6 primary antibodies -
Description
Rabbit polyclonal to NDUFS6 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Chimpanzee, Cynomolgus monkey, Gorilla -
Immunogen
Recombinant full length protein corresponding to Human NDUFS6 aa 29-124. Full length chain, without signal peptide.
Sequence:GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVS EVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH
Database link: O75380 -
Positive control
- WB: Mouse brain lysate; HepG2 whole cell lysate. IHC-P: Human adrenal gland and gastric cancer tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab230464 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/5000. Detects a band of approximately 14 kDa (predicted molecular weight: 13 kDa). | |
IHC-P | 1/20 - 1/200. |
Target
-
Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. -
Sequence similarities
Belongs to the complex I NDUFS6 subunit family. -
Cellular localization
Mitochondrion inner membrane. - Information by UniProt
-
Database links
- Entrez Gene: 742848 Chimpanzee
- Entrez Gene: 101865852 Cynomolgus monkey
- Entrez Gene: 101151434 Gorilla
- Entrez Gene: 4726 Human
- Entrez Gene: 407785 Mouse
- Omim: 603848 Human
- SwissProt: Q0MQH7 Chimpanzee
- SwissProt: Q4R5X8 Cynomolgus monkey
see all -
Alternative names
- BC059730 antibody
- CI 13kA antibody
- CI 13kD A antibody
see all
Images
-
All lanes : Anti-NDUFS6 antibody (ab230464) at 1/1000 dilution
Lane 1 : Mouse brain lysate
Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 13 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NDUFS6 antibody (ab230464)
Paraffin-embedded human adrenal gland tissue stained for NDUFS6 using ab230464 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NDUFS6 antibody (ab230464)
Paraffin-embedded human gastric cancer tissue stained for NDUFS6 using ab230464 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab230464 has not yet been referenced specifically in any publications.