Anti-NDUFS6 antibody (ab230464)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-NDUFS6 antibody
See all NDUFS6 primary antibodies -
Description
Rabbit polyclonal to NDUFS6 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Chimpanzee, Cynomolgus monkey, Gorilla
-
Immunogen
Recombinant full length protein corresponding to Human NDUFS6 aa 29-124. Full length chain, without signal peptide.
Sequence:GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVS EVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH
Database link: O75380 -
Positive control
- WB: Mouse brain lysate; HepG2 whole cell lysate. IHC-P: Human adrenal gland and gastric cancer tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab230464 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/1000 - 1/5000. Detects a band of approximately 14 kDa (predicted molecular weight: 13 kDa). | |
| IHC-P | 1/20 - 1/200. |
Target
-
Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. -
Sequence similarities
Belongs to the complex I NDUFS6 subunit family. -
Cellular localization
Mitochondrion inner membrane. - Information by UniProt
-
Database links
- Entrez Gene: 742848 Chimpanzee
- Entrez Gene: 101865852 Cynomolgus monkey
- Entrez Gene: 101151434 Gorilla
- Entrez Gene: 4726 Human
- Entrez Gene: 407785 Mouse
- Omim: 603848 Human
- SwissProt: Q0MQH7 Chimpanzee
- SwissProt: Q4R5X8 Cynomolgus monkey
see all -
Alternative names
- BC059730 antibody
- CI 13kA antibody
- CI 13kD A antibody
see all
Images
-
Western blot - Anti-NDUFS6 antibody (ab230464)All lanes : Anti-NDUFS6 antibody (ab230464) at 1/1000 dilution
Lane 1 : Mouse brain lysate
Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
Predicted band size: 13 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NDUFS6 antibody (ab230464)Paraffin-embedded human adrenal gland tissue stained for NDUFS6 using ab230464 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NDUFS6 antibody (ab230464)Paraffin-embedded human gastric cancer tissue stained for NDUFS6 using ab230464 at 1/100 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab230464 has not yet been referenced specifically in any publications.
