Overview

  • Product name

  • Description

    Rabbit polyclonal to NDUFS6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey, Gorilla
  • Immunogen

    Recombinant full length protein corresponding to Human NDUFS6 aa 29-124.
    Sequence:

    GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVS EVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH


    Database link: O75380

  • Positive control

    • WB: Mouse heart and kidney lysates; MCF7 and HepG2 whole cell lysates. IHC-P: Human adrenal gland and gastric cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230481 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 14 kDa (predicted molecular weight: 13 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities

    Belongs to the complex I NDUFS6 subunit family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • BC059730 antibody
    • CI 13kA antibody
    • CI 13kD A antibody
    • CI-13kD-A antibody
    • CI13KDA antibody
    • Complex I 13kD A antibody
    • Complex I 13kDa subunit A antibody
    • Complex I mitochondrial respiratory chain 13 kD subunit antibody
    • Complex I-13kD-A antibody
    • IP13 antibody
    • MGC107676 antibody
    • NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH coenzyme Q reductase) antibody
    • NADH dehydrogenase [ubiquinone] iron sulfur protein 6, mitochondrial antibody
    • NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial antibody
    • NADH ubiquinone oxidoreductase 13 kDa A subunit antibody
    • NADH-ubiquinone oxidoreductase 13 kDa-A subunit antibody
    • NADH:ubiquinone oxidoreductase NDUFS6 subunit antibody
    • NADH:ubiquinone oxidoreductase subunit S6 antibody
    • Ndufs6 antibody
    • NDUS6_HUMAN antibody
    see all

Images

  • All lanes : Anti-NDUFS6 antibody (ab230481) at 1/1000 dilution

    Lane 1 : Mouse heart lysate
    Lane 2 : Mouse kidney lysate
    Lane 3 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 4 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 13 kDa
    Observed band size: 14 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human adrenal gland tissue stained for NDUFS6 using ab230481 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for NDUFS6 using ab230481 at 1/100 dilution in immunohistochemical analysis.

References

ab230481 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230481.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up