Overview

  • Product name

    Anti-NDUFV2 antibody - N-terminal
    See all NDUFV2 primary antibodies
  • Description

    Rabbit polyclonal to NDUFV2 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NDUFV2 aa 1-70 (N terminal).
    Sequence:

    MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPD TPFDFTPENYKRIEAIVKNY


    Database link: P19404

  • Positive control

    • ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/triton X-100

Target

  • Function

    Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities

    Belongs to the complex I 24 kDa subunit family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 24kDa subunit of Complex I antibody
    • CI-24k antibody
    • complex I 24kDa subunit antibody
    • complex I, mitochondrial respiratory 2 antibody
    • mitochondrial antibody
    • NADH dehydrogenase (ubiquinone) flavoprotein 2 antibody
    • NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa antibody
    • NADH dehydrogenase [ubiquinone] flavoprotein 2 antibody
    • NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial antibody
    • NADH ubiquinone oxidoreductase 24 kDa subunit antibody
    • NADH-ubiquinone oxidoreductase 24 kDa subunit antibody
    • NADH-ubiquinone oxidoreductase flavoprotein 2 antibody
    • NDUFV2 antibody
    • NDUV2_HUMAN antibody
    • nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit antibody
    • Ubiquinoneflavoprotein 2 antibody
    • Ubiquinoneflavoprotein 2, mitochondrial precursor antibody
    see all

Images

  • 4% paraformaldehyde-fixed, 0.1% Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for NDUFV2 using ab222243 at 4 µg/ml in ICC/IF.

References

ab222243 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up