Overview

  • Product name

  • Description

    Rabbit polyclonal to Nebulette
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human Nebulette aa 360-403 conjugated to keyhole limpet haemocyanin.
    Sequence:

    YQASKEAQKMQSEKVYKEDFEKEIKGRSSLDLDKTPEFLHVKYI


    Database link: O76041

  • Positive control

    • IHC-P: Mouse heart tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Relevance

    Nebulette binds to actin and plays an important role in Z-disk assembly. It is a cardiac homolog of nebulin and its expression is abundant in cardiac muscle. Nebulette defects are assocated with non-familial idiopathic cardiacmyopathy
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • 1200007O21Rik antibody
    • A630080F05Rik antibody
    • Actin binding Z disk protein antibody
    • bA56H7.1 antibody
    • BB140644 antibody
    • D830029A09Rik antibody
    • LIM nebulette antibody
    • LNEBL antibody
    • MGC118387 antibody
    • NEBL antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded mouse heart tissue labeling Nebulette with ab214377 at 1/200 followed by conjugation to the secondary antibody and DAB staining.

References

ab214377 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up