Overview

  • Product name

  • Description

    Rabbit polyclonal to NECAB1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NECAB1 aa 135-198.
    Sequence:

    LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSS RRVQRHNSFSPNSP


    Database link: Q8N987

  • Positive control

    • WB: Human and mouse cerebral cortex lysate. RT4 cell lysate. IHC-P: Mouse parietal association cortex, hippocampus, superior colliculi, vestibular nucleus and human cerebral cortex, hippocampus and lateral ventrical tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224450 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 41 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Paraffin embedded mouse parietal association cortex tissue stained for NECAB1 with ab224450 (1/1000 dilution) in immunohistochemical analysis.

  • Anti-NECAB1 antibody (ab224450) at 1/100 dilution + Mouse cerebral cortex tissue lysate

    Predicted band size: 41 kDa

  • Paraffin embedded human lateral ventricle tissue stained for NECAB1 with ab224450 (1/1000 dilution) in immunohistochemical analysis.

  • Paraffin embedded human hippocampus tissue stained for NECAB1 with ab224450 (1/1000 dilution) in immunohistochemical analysis.

  • Paraffin embedded mouse vestibular nucleus tissue stained for NECAB1 with ab224450 (1/1000 dilution) in immunohistochemical analysis.

  • Paraffin embedded mouse superior colliculi tissue stained for NECAB1 with ab224450 (1/1000 dilution) in immunohistochemical analysis.

  • Paraffin embedded mouse hippocampus tissue stained for NECAB1 with ab224450 (1/1000 dilution) in immunohistochemical analysis.

  • Paraffin embedded human cerebral cortex tissue stained for NECAB1 with ab224450 (1/1000 dilution) in immunohistochemical analysis.

  • Anti-NECAB1 antibody (ab224450) at 1/100 dilution + Human cerebral cortex tissue lysate

    Predicted band size: 41 kDa

  • Anti-NECAB1 antibody (ab224450) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 41 kDa

References

ab224450 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224450.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up