Overview

  • Product name

    Anti-NECAB1 antibody [CL0575]
    See all NECAB1 primary antibodies
  • Description

    Mouse monoclonal [CL0575] to NECAB1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NECAB1 aa 135-198.
    Sequence:

    LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSS RRVQRHNSFSPNSP


    Database link: Q8N987

  • Epitope

    Binds to an epitope located within the peptidesequence SIQWPGKRSS as determined by overlapping synthetic peptides.
  • Positive control

    • IHC-P: Human cerebral cotex and kidney tissues. WB: Human cerebral cortex lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab244217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 41 kDa.

Target

Images

  • Paraffin-embedded human cerebral cortex tissue stained for NECAB1 using ab244217 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for NECAB1 using ab244217 at 1/500 dilution in immunohistochemical analysis.

  • Anti-NECAB1 antibody [CL0575] (ab244217) at 1 µg/ml + Human cerebral cortex lysate

    Predicted band size: 41 kDa

  • Paraffin-embedded human liver tissue stained for NECAB1 using ab244217 at 1/500 dilution in immunohistochemical analysis. Negative control.

References

ab244217 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up