Overview

  • Product name

    Anti-NECAB2 antibody [CL0524]
  • Description

    Mouse monoclonal [CL0524] to NECAB2
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment within Human NECAB2 aa 239-378. The exact sequence is proprietary.
    Sequence:

    ATEDAKEEGLEAQISRLAELIGRLESKALWFDLQQRLSDEDGTNMHLQLV RQEMAVCPEQLSEFLDSLRQYLRGTTGVRNCFHITAVRLSDGFTFVIYEF WETEEAWKRHLQSPLCKAFRHVKVDTLSQPEALSRILVPA


    Database link: Q7Z6G3

  • Epitope

    This antibody binds to an epitope located within the peptide sequence IGRLESKALWFDLQQ (aa 259-273).
  • Positive control

    • Human cerebral cortex and colon tissues.
  • General notes

     This product was previously labelled as EFCBP2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab211464 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Expressed in brain.
  • Sequence similarities

    Contains 1 ABM domain.
    Contains 2 EF-hand domains.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • EF hand calcium binding protein 2 antibody
    • EF-hand calcium-binding protein 2 antibody
    • N-terminal EF-hand calcium-binding protein 2 antibody
    • NECA2_HUMAN antibody
    • Necab2 antibody
    • Neuronal calcium binding protein 2 antibody
    • Neuronal calcium-binding protein 2 antibody
    • Stip 2 antibody
    • Stip-2 antibody
    • Stip2 antibody
    • Synaptotagmin interacting protein 2 antibody
    • Synaptotagmin-interacting protein 2 antibody
    see all

Images

  • Immunohistochemical analysis of human cerebral cortex tissue labeling NECAB2 with ab211464 at 1/500 dilution.

  • Immunohistochemical analysis of human colon tissue labeling NECAB2 with ab211464 at 1/500 dilution.

  • Negative control: Immunohistochemical analysis of human liver tissue labeling NECAB2 with ab211464 at 1/500 dilution.

References

ab211464 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211464.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up