For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    necdin-antibody-ab227908.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Cell Cycle Cell Cycle Inhibitors Other
Share by email

Anti-Necdin antibody (ab227908)

  • Datasheet
Submit a review Submit a question References (18)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-Necdin antibody (ab227908)
  • Immunohistochemistry (Frozen sections) - Anti-Necdin antibody (ab227908)
  • Immunohistochemistry (Frozen sections) - Anti-Necdin antibody (ab227908)

Key features and details

  • Rabbit polyclonal to Necdin
  • Suitable for: IHC-Fr, WB
  • Reacts with: Mouse
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-Necdin antibody
  • Description

    Rabbit polyclonal to Necdin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Fr, WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Mouse Necdin aa 83-325.
    Sequence:

    AHQPQSPARPIPAPPAPAQLVQKAHELMWYVLVKDQKRMVLWFPDMVKEV MGSYKKWCRSILRRTSVILARVFGLHLRLTNLHTMEFALVKALSPEELDR VALNNRMPMTGLLLMILSLIYVKGRGAREGAVWNVLRILGLRPWKKHSTF GDVRKIITEEFVQQNYLKYQRVPHIEPPEYEFFWGSRANREITKMQIMEF LARVFKKDPQAWPSRYREALEQARALREANLAAQAPRSSVSED


    Database link: P25233
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Mouse E16.5 embryo cerebral cortex lysate. IHC-Fr: Mouse E14.5 forebrain and E13.5 cervical dorsal root ganglion tissues.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 6.5
    Constituents: PBS, 50% Glycerol (glycerin, glycerine)

    Filter-sterilized. No additive.
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Cell Cycle
    • Cell Cycle Inhibitors
    • Other
    • Neuroscience
    • Cell Type Marker
    • Neuron marker
    • Soma marker

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

Applications

Our Abpromise guarantee covers the use of ab227908 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr 1/500.
WB 1/1000 - 1/3000. Predicted molecular weight: 37 kDa.

Target

  • Function

    Growth suppressor that facilitates the entry of the cell into cell cycle arrest. Functionally similar to the retinoblastoma protein it binds to and represses the activity of cell-cycle-promoting proteins such as SV40 large T antigen, adenovirus E1A, and the transcription factor E2F. Necdin also interacts with p53 and works in an additive manner to inhibit cell growth. Functions also as transcription factor and binds directly to specific guanosine-rich DNA sequences.
  • Tissue specificity

    Almost ubiquitous. Detected in fetal brain, lung, liver and kidney; in adult heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon. Not detected in peripheral blood leukocytes. In brain, restricted to post-mitotic neurons.
  • Sequence similarities

    Contains 1 MAGE domain.
  • Cellular localization

    Perikaryon. Nucleus. Neural perikarya, translocates to the nucleus of postmitotic neurons and interacts with the nuclear matrix.
  • Target information above from: UniProt accession Q99608 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 4692 Human
    • Entrez Gene: 17984 Mouse
    • Omim: 602117 Human
    • SwissProt: Q99608 Human
    • SwissProt: P25233 Mouse
    • Unigene: 50130 Human
    • Unigene: 400253 Mouse
    • Alternative names

      • HsT16328 antibody
      • NDN antibody
      • NECD_HUMAN antibody
      • Necdin antibody
      • Necdin homolog antibody
      • Necdin MAGE family member antibody
      • necdin related protein antibody
      • PWCR antibody
      see all

    Images

    • Western blot - Anti-Necdin antibody (ab227908)
      Western blot - Anti-Necdin antibody (ab227908)
      Anti-Necdin antibody (ab227908) at 1/3000 dilution + Mouse E16.5 embryo cerebral cortex lysate at 20 µg

      Predicted band size: 37 kDa



      The larger size may reflect post-translational modifications such as ubiquitination and phosphorylation at several sites.

    • Immunohistochemistry (Frozen sections) - Anti-Necdin antibody (ab227908)
      Immunohistochemistry (Frozen sections) - Anti-Necdin antibody (ab227908)

      Cryosections of cervical dorsal root ganglion tissues from wild type (left panel) and Necdin-knockout (right panel) mouse E14.5 stained for Necdin using ab227908 at 1/500 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Frozen sections) - Anti-Necdin antibody (ab227908)
      Immunohistochemistry (Frozen sections) - Anti-Necdin antibody (ab227908)

      Frozen sections of mouse E13.5 forebrain stained for Necdin using ab227908 at 1/500 dilution in immunohistochemical analysis. CX, Cortex; LV, lateral ventricle; LGE, lateral ganglionic eminence; SP, septum.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (18)

    Publishing research using ab227908? Please let us know so that we can cite the reference in this datasheet.

    ab227908 has been referenced in 18 publications.

    • Hasegawa K  et al. Promotion of mitochondrial biogenesis by necdin protects neurons against mitochondrial insults. Nat Commun 7:10943 (2016). WB, IHC-Fr ; Mouse . PubMed: 26971449
    • Fujimoto I  et al. Necdin controls EGFR signaling linked to astrocyte differentiation in primary cortical progenitor cells. Cell Signal 28:94-107 (2016). WB, IP ; Mouse . PubMed: 26655377
    • Minamide R  et al. Antagonistic interplay between necdin and Bmi1 controls proliferation of neural precursor cells in the embryonic mouse neocortex. PLoS One 9:e84460 (2014). WB, IP, IF ; Mouse . PubMed: 24392139
    • Morillo SM  et al. Nerve growth factor-induced cell cycle reentry in newborn neurons is triggered by p38MAPK-dependent E2F4 phosphorylation. Mol Cell Biol 32:2722-37 (2012). WB, IP ; Chicken . PubMed: 22586272
    • Kubota Y  et al. Necdin restricts proliferation of hematopoietic stem cells during hematopoietic regeneration. Blood 114:4383-92 (2009). IF ; Mouse . PubMed: 19770359
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab227908.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.