Anti-Necdin antibody (ab227908)

Submit a review Submit a question References (18)

Overview

  • Product name

    Anti-Necdin antibody

  • Description

    Rabbit polyclonal to Necdin

  • Host species

    Rabbit

  • Tested applications

    Suitable for: IHC-Fr, WBmore details

  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Human

  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Mouse Necdin aa 83-325.
    Sequence:

    AHQPQSPARPIPAPPAPAQLVQKAHELMWYVLVKDQKRMVLWFPDMVKEV MGSYKKWCRSILRRTSVILARVFGLHLRLTNLHTMEFALVKALSPEELDR VALNNRMPMTGLLLMILSLIYVKGRGAREGAVWNVLRILGLRPWKKHSTF GDVRKIITEEFVQQNYLKYQRVPHIEPPEYEFFWGSRANREITKMQIMEF LARVFKKDPQAWPSRYREALEQARALREANLAAQAPRSSVSED


    Database link: P25233

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: Mouse E16.5 embryo cerebral cortex lysate. IHC-Fr: Mouse E14.5 forebrain and E13.5 cervical dorsal root ganglion tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab227908 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr 1/500.
WB 1/1000 - 1/3000. Predicted molecular weight: 37 kDa.

Target

  • Function

    Growth suppressor that facilitates the entry of the cell into cell cycle arrest. Functionally similar to the retinoblastoma protein it binds to and represses the activity of cell-cycle-promoting proteins such as SV40 large T antigen, adenovirus E1A, and the transcription factor E2F. Necdin also interacts with p53 and works in an additive manner to inhibit cell growth. Functions also as transcription factor and binds directly to specific guanosine-rich DNA sequences.

  • Tissue specificity

    Almost ubiquitous. Detected in fetal brain, lung, liver and kidney; in adult heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon. Not detected in peripheral blood leukocytes. In brain, restricted to post-mitotic neurons.

  • Sequence similarities

    Contains 1 MAGE domain.

  • Cellular localization

    Perikaryon. Nucleus. Neural perikarya, translocates to the nucleus of postmitotic neurons and interacts with the nuclear matrix.
  • Information by UniProt

  • Database links

    • Alternative names

      • HsT16328 antibody
      • NDN antibody
      • NECD_HUMAN antibody
      • Necdin antibody
      • Necdin homolog antibody
      • Necdin MAGE family member antibody
      • necdin related protein antibody
      • PWCR antibody
      see all

    Images

    • Western blot - Anti-Necdin antibody (ab227908)
      Western blot - Anti-Necdin antibody (ab227908)
      Anti-Necdin antibody (ab227908) at 1/3000 dilution + Mouse E16.5 embryo cerebral cortex lysate at 20 µg

      Predicted band size: 37 kDa



      The larger size may reflect post-translational modifications such as ubiquitination and phosphorylation at several sites.

    • Immunohistochemistry (Frozen sections) - Anti-Necdin antibody (ab227908)
      Immunohistochemistry (Frozen sections) - Anti-Necdin antibody (ab227908)

      Cryosections of cervical dorsal root ganglion tissues from wild type (left panel) and Necdin-knockout (right panel) mouse E14.5 stained for Necdin using ab227908 at 1/500 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Frozen sections) - Anti-Necdin antibody (ab227908)
      Immunohistochemistry (Frozen sections) - Anti-Necdin antibody (ab227908)

      Frozen sections of mouse E13.5 forebrain stained for Necdin using ab227908 at 1/500 dilution in immunohistochemical analysis. CX, Cortex; LV, lateral ventricle; LGE, lateral ganglionic eminence; SP, septum.

    References

    This product has been referenced in:

    • Hasegawa K  et al. Promotion of mitochondrial biogenesis by necdin protects neurons against mitochondrial insults. Nat Commun 7:10943 (2016). WB, IHC-Fr ; Mouse . Read more (PubMed: 26971449) »
    • Fujimoto I  et al. Necdin controls EGFR signaling linked to astrocyte differentiation in primary cortical progenitor cells. Cell Signal 28:94-107 (2016). WB, IP ; Mouse . Read more (PubMed: 26655377) »
    See all 18 Publications for this product

    Publishing research using ab227908? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab227908.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com