Anti-Necdin antibody (ab227908)
Key features and details
- Rabbit polyclonal to Necdin
- Suitable for: IHC-Fr, WB
- Reacts with: Mouse
- Isotype: IgG
Overview
-
Product name
Anti-Necdin antibody -
Description
Rabbit polyclonal to Necdin -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Fr, WBmore details -
Species reactivity
Reacts with: Mouse
Predicted to work with: Human -
Immunogen
Recombinant fragment (GST-tag) corresponding to Mouse Necdin aa 83-325.
Sequence:AHQPQSPARPIPAPPAPAQLVQKAHELMWYVLVKDQKRMVLWFPDMVKEV MGSYKKWCRSILRRTSVILARVFGLHLRLTNLHTMEFALVKALSPEELDR VALNNRMPMTGLLLMILSLIYVKGRGAREGAVWNVLRILGLRPWKKHSTF GDVRKIITEEFVQQNYLKYQRVPHIEPPEYEFFWGSRANREITKMQIMEF LARVFKKDPQAWPSRYREALEQARALREANLAAQAPRSSVSED
Database link: P25233 -
Positive control
- WB: Mouse E16.5 embryo cerebral cortex lysate. IHC-Fr: Mouse E14.5 forebrain and E13.5 cervical dorsal root ganglion tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.5
Constituents: PBS, 50% Glycerol (glycerin, glycerine)
Filter-sterilized. No additive. -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab227908 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-Fr | 1/500. | |
WB | 1/1000 - 1/3000. Predicted molecular weight: 37 kDa. |
Target
-
Function
Growth suppressor that facilitates the entry of the cell into cell cycle arrest. Functionally similar to the retinoblastoma protein it binds to and represses the activity of cell-cycle-promoting proteins such as SV40 large T antigen, adenovirus E1A, and the transcription factor E2F. Necdin also interacts with p53 and works in an additive manner to inhibit cell growth. Functions also as transcription factor and binds directly to specific guanosine-rich DNA sequences. -
Tissue specificity
Almost ubiquitous. Detected in fetal brain, lung, liver and kidney; in adult heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon. Not detected in peripheral blood leukocytes. In brain, restricted to post-mitotic neurons. -
Sequence similarities
Contains 1 MAGE domain. -
Cellular localization
Perikaryon. Nucleus. Neural perikarya, translocates to the nucleus of postmitotic neurons and interacts with the nuclear matrix. - Information by UniProt
-
Database links
- Entrez Gene: 4692 Human
- Entrez Gene: 17984 Mouse
- Omim: 602117 Human
- SwissProt: Q99608 Human
- SwissProt: P25233 Mouse
- Unigene: 50130 Human
- Unigene: 400253 Mouse
-
Alternative names
- HsT16328 antibody
- NDN antibody
- NECD_HUMAN antibody
see all
Images
-
Anti-Necdin antibody (ab227908) at 1/3000 dilution + Mouse E16.5 embryo cerebral cortex lysate at 20 µg
Predicted band size: 37 kDaThe larger size may reflect post-translational modifications such as ubiquitination and phosphorylation at several sites.
-
Cryosections of cervical dorsal root ganglion tissues from wild type (left panel) and Necdin-knockout (right panel) mouse E14.5 stained for Necdin using ab227908 at 1/500 dilution in immunohistochemical analysis.
-
Frozen sections of mouse E13.5 forebrain stained for Necdin using ab227908 at 1/500 dilution in immunohistochemical analysis. CX, Cortex; LV, lateral ventricle; LGE, lateral ganglionic eminence; SP, septum.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (18)
ab227908 has been referenced in 18 publications.
- Hasegawa K et al. Promotion of mitochondrial biogenesis by necdin protects neurons against mitochondrial insults. Nat Commun 7:10943 (2016). WB, IHC-Fr ; Mouse . PubMed: 26971449
- Fujimoto I et al. Necdin controls EGFR signaling linked to astrocyte differentiation in primary cortical progenitor cells. Cell Signal 28:94-107 (2016). WB, IP ; Mouse . PubMed: 26655377
- Minamide R et al. Antagonistic interplay between necdin and Bmi1 controls proliferation of neural precursor cells in the embryonic mouse neocortex. PLoS One 9:e84460 (2014). WB, IP, IF ; Mouse . PubMed: 24392139
- Morillo SM et al. Nerve growth factor-induced cell cycle reentry in newborn neurons is triggered by p38MAPK-dependent E2F4 phosphorylation. Mol Cell Biol 32:2722-37 (2012). WB, IP ; Chicken . PubMed: 22586272
- Kubota Y et al. Necdin restricts proliferation of hematopoietic stem cells during hematopoietic regeneration. Blood 114:4383-92 (2009). IF ; Mouse . PubMed: 19770359