Overview

  • Product name

  • Description

    Rabbit polyclonal to NEDD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human NEDD1 aa 411-660.
    Sequence:

    SPIRDDAVVNKGSDESIGKGDGFDFLPQLNSVFPPRKNPVTSSTSVLHSS PLNVFMGSPGKEENENRDLTAESKKIYMGKQESKDSFKQLAKLVTSGAES GNLNTSPSSNQTRNSEKFEKPENEIEAQLICEPPINGSSTPNPKIASSVT AGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRD IVNLQVEMIKQFHMQLNEMHSLLERYSVNEGLVAEIERLREENKRLRAHF


    Database link: Q8NHV4

  • Positive control

    • WB: Mouse brain lysate; Jurkat whole cell lysate. IHC-P: Human glioma cancer tissue. IP: HeLa whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab230201 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 72 kDa.
IP 1/200 - 1/2000.

Target

Images

  • All lanes : Anti-NEDD1 antibody (ab230201) at 1/1000 dilution

    Lane 1 : Mouse brain lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 72 kDa

  • Paraffin-embedded human glioma cancer tissue stained for NEDD1 using ab230201 at 1/100 dilution in immunohistochemical analysis.

  • NEDD1 was immunoprecipitated from 500 µg HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate using 4 µg of ab230201.

    Lane 1: 1 µg Rabbit monoclonal IgG instead of ab230201 in HeLa whole cell lysate.

    Lane 2: ab230201 IP in HeLa whole cell lysate.

    Lane 3: HeLa whole cell lysate 20 µg (input).

    For western blotting, an HRP-conjugated light chain specific antibody was used as the Secondary antibody at 1/50000 dilution.

References

ab230201 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230201.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up