Overview

  • Product name

  • Description

    Rabbit polyclonal to NEDD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human NEDD1 aa 411-660.
    Sequence:

    SPIRDDAVVNKGSDESIGKGDGFDFLPQLNSVFPPRKNPVTSSTSVLHSS PLNVFMGSPGKEENENRDLTAESKKIYMGKQESKDSFKQLAKLVTSGAES GNLNTSPSSNQTRNSEKFEKPENEIEAQLICEPPINGSSTPNPKIASSVT AGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRD IVNLQVEMIKQFHMQLNEMHSLLERYSVNEGLVAEIERLREENKRLRAHF


    Database link: Q8NHV4

  • Positive control

    • WB: Mouse small intestine tissue lysate and Jurkat whole cell lysate (ab7899). IHC-P: Human glioma cancer and thyroid tissue. IP: NEDD1 IP in HeLa whole cell lysate (ab150035).

Properties

Applications

Our Abpromise guarantee covers the use of ab230254 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-NEDD1 antibody (ab230254) at 1/1000 dilution

    Lane 1 : Mouse small intestine tissue lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    All lanes : Goat anti-rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Observed band size: 72 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human glioma cancer tissue stained for NEDD1 using ab230254 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thyroid tissue stained for NEDD1 using ab230254 at 1/100 dilution in immunohistochemical analysis.

  • NEDD1 was immunoprecipitated from 0.5 mg of HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate with 4 μg ab230254. Western blot was performed from the immunoprecipitate using ab230254. An HRP-conjugated light chain specific antibody was used as secondary antibody at 1/50,000 dilution.

    Lane 1: Rabbit monoclonal IgG (1 μg) instead of ab230254 in HeLa whole cell lysate.

    Lane 2: ab230254 IP in HeLa whole cell lysate. 

    Lane 3: HeLa whole cell lysate 20 µg (Input).

References

ab230254 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230254.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up