Overview

  • Product name

  • Description

    Rabbit polyclonal to NEDD8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Cow, Caenorhabditis elegans, Drosophila melanogaster
  • Immunogen

    Recombinant full length protein corresponding to Human NEDD8 aa 1-81.
    Sequence:

    MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQM NDEKTAADYKILGGSVLHLVLALRGGGGLRQ


    Database link: Q15843

  • Positive control

    • Extracts of Cos1, jurkat and brain cells; HeLa cell; Mouse brain lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 9 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function

    Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.
  • Tissue specificity

    Highly expressed in heart, skeletal muscle, spleen, thymus, prostate, testis, ovary, colon and leukocytes.
  • Sequence similarities

    Belongs to the ubiquitin family.
  • Post-translational
    modifications

    Cleavage of precursor form by UCHL3 or SENP8 is necessary for function.
  • Cellular localization

    Nucleus. Mainly nuclear.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ43224 antibody
    • MGC104393 antibody
    • MGC125896 antibody
    • MGC125897 antibody
    • NED8 antibody
    • NEDD 8 antibody
    • NEDD-8 antibody
    • Nedd8 antibody
    • NEDD8_HUMAN antibody
    • Neddylin antibody
    • Neural precursor cell expressed developmentally down regulated 8 antibody
    • Neural precursor cell expressed developmentally down regulated gene 8 antibody
    • Neural precursor cell expressed developmentally down-regulated protein 8 antibody
    • Rub1 antibody
    • Ubiquitin like protein Nedd 8 antibody
    • Ubiquitin like protein Nedd8 antibody
    • Ubiquitin-like protein Nedd8 antibody
    see all

Images

  • All lanes : Anti-NEDD8 antibody (ab194582) at 1/500 dilution

    Lane 1 : COS7 cell lysate
    Lane 2 : Jurkat cell lysate
    Lane 3 : Mouse brain lysate

    Predicted band size: 9 kDa

  • Immunofluorescent analysis of Hela cell labeling NEDD8 using ab194582 at a 1/50 dilution.

References

ab194582 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (HeLa)
Permeabilization
Yes - 0.5% Triton X-100
Specification
HeLa
Fixative
Paraformaldehyde

Dr. Kirk Mcmanus

Verified customer

Submitted Aug 10 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up