For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    nedl1-antibody-ab121265.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Apoptosis Intracellular p53 Pathway
Share by email

Anti-NEDL1 antibody (ab121265)

  • Datasheet
Submit a review Q&A (3)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NEDL1 antibody (ab121265)
  • Immunocytochemistry/ Immunofluorescence - Anti-NEDL1 antibody (ab121265)

Key features and details

  • Rabbit polyclonal to NEDL1
  • Suitable for: IHC-P, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-NEDL1 antibody
    See all NEDL1 primary antibodies
  • Description

    Rabbit polyclonal to NEDL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NEDL1 aa 356-481.

  • Positive control

    • Human pancreas tissue; A431 cells.
  • General notes

    Previously labelled as HECW1. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cell Biology
    • Apoptosis
    • Intracellular
    • p53 Pathway
    • Cell Biology
    • Proteolysis / Ubiquitin
    • Proteasome / Ubiquitin
    • Ubiquitin E3 Enzymes
    • Hect E3 Ligase
    • Neuroscience
    • Neurology process
    • Neurodegenerative disease
    • Amyotrophic lateral sclerosis
    • Epigenetics and Nuclear Signaling
    • Ubiquitin & Ubiquitin Like Modifiers
    • E3 Ubiquitin Ligases

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

Applications

Our Abpromise guarantee covers the use of ab121265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent degradation of DVL1. Also targets the mutant SOD1 protein involved in familial amyotrophic lateral sclerosis (FALS). Forms cytotoxic aggregates with DVL1, SSR3 and mutant SOD1 that lead to motor neuron death in FALS.
  • Tissue specificity

    Predominantly expressed in neurons of adult and fetal brain. Weakly expressed in the kidney.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 C2 domain.
    Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.
    Contains 2 WW domains.
  • Cellular localization

    Cytoplasm.
  • Target information above from: UniProt accession Q76N89 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 23072 Human
    • Omim: 610384 Human
    • SwissProt: Q76N89 Human
    • Unigene: 164453 Human
    • Alternative names

      • C2 and WW domain-containing protein 1 antibody
      • E3 ubiquitin-protein ligase HECW1 antibody
      • HECT antibody
      • HECT type E3 ubiquitin ligase antibody
      • HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1 antibody
      • HECT, C2 and WW domain-containing protein 1 antibody
      • HECW 1 antibody
      • Hecw1 antibody
      • HECW1_HUMAN antibody
      • hNEDL1 antibody
      • NEDD4 like ubiquitin protein ligase 1 antibody
      • NEDD4-like E3 ubiquitin-protein ligase 1 antibody
      • NEDL1 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NEDL1 antibody (ab121265)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NEDL1 antibody (ab121265)

      ab121265 at 1/25 dilution staining NEDL1 in Paraffin-embedded Human pancreas tissue by Immunohistochemistry.

    • Immunocytochemistry/ Immunofluorescence - Anti-NEDL1 antibody (ab121265)
      Immunocytochemistry/ Immunofluorescence - Anti-NEDL1 antibody (ab121265)

      ab121265 at 4 &microg/ml staining NEDL1 in PFA/Triton X-100 fixed/permeabilized A431 cells by Immunofluorescence (green).

    Protocols

    • Immunohistochemistry protocols
    • Immunocytochemistry & immunofluorescence protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab121265? Please let us know so that we can cite the reference in this datasheet.

    ab121265 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-3 of 3 Abreviews or Q&A

    Question

    No this is not the answer I excpected. My questions were:

    Would it be possible for you to send me the full antigen sequences? (For the two antibodies in the subject line, not HAT1!) Wich one would you recommend for WB analysis?
    What discount can you offer if I purchase 2-3 vials of each antibody (that is 4-6 vials in total) to test. If one of them works well I will probably need approximately 40 vials. What kind of discount would I get for that quantity?

    The answer "The full sequence of Human HAT1 as follows:
    >sp"
    is not what I expected.

    Please let me know if it will be possible to get the full antigen sequences for your antibodies ab121264 and ab121265 (Anti-HECW1), which one you would recommend for WB and what kind of discounts you may offer.

    Thanks,

    Read More

    Abcam community

    Verified customer

    Asked on Apr 27 2012

    Answer

    Thank very much for your email. First, I would like to apologize as I have no idea why I pasted HAT1 sequence in my email; a totally unrelated antibody because we also take phone calls so maybe there was mix up. I apologize for any inconvenience.
    The immunogen sequence as we know is from amino acid 356-481 for ab121265 and from amino acid 500-614 for ab121264. We unfortunately can not disclose the exact sequence which is a proprietary information; we however can fully guarantee that the antibodies will detect the target protein in applications (IHC-P and ICC/IF) and species (human) as listed on the datasheet.
    WB unfortunately is an untested application for both of these antibodies however because both of these antibodies are tested in IHC-P which involves denaturation of antigens like WB so it is more likely that both antibodies, would be suitable. If you are interested in using these I can provide you 100% Abreview discount codes. The discount codes will be worth the price for these antibodies which mean if you buy these antibodies and submit WB Abreviews, irrespective of positive or negative you can get next purchase of two antibodies totally free of charge.
    Full terms and conditions can be found at the following link;

    https://www.abcam.com/index.html?pageconfig=resource&rid=11998&viapagetrap=collaborationdiscount

    I hope this info will be helpful. Should you have any question please do not hesitate to contact me.

    Read More

    Abcam Scientific Support

    Answered on Apr 27 2012

    Question

    Thanks for your answer.

    Would it be possible for you to send me the full antigen sequence? Wich one would you recommend for WB analysis?

    What discount can you offer if I purchase 2-3 vials of each antibody (that is 4-6 vials in total) to test. If one of them works well I will probably need approximately 40 vials. What kind of discount would I get for that quantity?

    Thanks,

    Read More

    Abcam community

    Verified customer

    Asked on Apr 19 2012

    Answer

    Thank you for contacting us.
    The full sequence of Human HAT1 as follows:
    >sp|O14929|HAT1_HUMAN Histone acetyltransferase type B catalytic subunit OS=Homo sapiens GN=HAT1 PE=1 SV=1
    MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLF
    GDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFC
    TNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQT
    FLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQ
    MLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCF
    SREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLI
    SPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
    http://www.uniprot.org/uniprot/O14929
    We always run promotions in different countries e.g. 4 for 3. Could you let me know which country you belong to, I will then tell you if the special price promotion is running or not?
    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.
    Use our products? Submit an Abreview. Earn rewards!
    https://www.abcam.com/abreviews

    Read More

    Abcam Scientific Support

    Answered on Apr 19 2012

    Question

    What is the difference between your two antibodies for HECW1, product numbers ab121264 and ab121265?
    Can I get a discount if I order several vials at the same time?
    Best regards,

    Read More

    Abcam community

    Verified customer

    Asked on Apr 05 2012

    Answer

    Thank you for contacting us.
    The main difference between the two is Immunogen. The immunogen of ab12164 corresponds to amino acid 500-614 and for ab121265 is from aa 356-481.
    The other difference is conc. of antibodies.
    I am glad to hear that you are willing to order several vial. The discount will depend on the number of vial you order so could you tell us how many vials you would like to purchase?
    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Read More

    Abcam Scientific Support

    Answered on Apr 05 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.