Anti-NEDL1 antibody (ab121265)

Submit a review Q&A (3)

Overview

  • Product name

    Anti-NEDL1 antibody
    See all NEDL1 primary antibodies

  • Description

    Rabbit polyclonal to NEDL1

  • Host species

    Rabbit

  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details

  • Species reactivity

    Reacts with: Human

  • Immunogen

    Recombinant fragment corresponding to Human NEDL1 aa 356-481.

  • Positive control

    • Human pancreas tissue; A431 cells.

  • General notes

    Previously labelled as HECW1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab121265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent degradation of DVL1. Also targets the mutant SOD1 protein involved in familial amyotrophic lateral sclerosis (FALS). Forms cytotoxic aggregates with DVL1, SSR3 and mutant SOD1 that lead to motor neuron death in FALS.

  • Tissue specificity

    Predominantly expressed in neurons of adult and fetal brain. Weakly expressed in the kidney.

  • Pathway

    Protein modification; protein ubiquitination.

  • Sequence similarities

    Contains 1 C2 domain.
    Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.
    Contains 2 WW domains.

  • Cellular localization

    Cytoplasm.
  • Information by UniProt

  • Database links

    • Alternative names

      • C2 and WW domain-containing protein 1 antibody
      • E3 ubiquitin-protein ligase HECW1 antibody
      • HECT antibody
      • HECT type E3 ubiquitin ligase antibody
      • HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1 antibody
      • HECT, C2 and WW domain-containing protein 1 antibody
      • HECW 1 antibody
      • Hecw1 antibody
      • HECW1_HUMAN antibody
      • hNEDL1 antibody
      • NEDD4 like ubiquitin protein ligase 1 antibody
      • NEDD4-like E3 ubiquitin-protein ligase 1 antibody
      • NEDL1 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NEDL1 antibody (ab121265)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-NEDL1 antibody (ab121265)

      ab121265 at 1/25 dilution staining NEDL1 in Paraffin-embedded Human pancreas tissue by Immunohistochemistry.

    • Immunocytochemistry/ Immunofluorescence - Anti-NEDL1 antibody (ab121265)
      Immunocytochemistry/ Immunofluorescence - Anti-NEDL1 antibody (ab121265)

      ab121265 at 4 &microg/ml staining NEDL1 in PFA/Triton X-100 fixed/permeabilized A431 cells by Immunofluorescence (green).

    References

    ab121265 has not yet been referenced specifically in any publications.

    Publishing research using ab121265? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-3 of 3 Abreviews or Q&A

    Question

    No this is not the answer I excpected. My questions were:

    Would it be possible for you to send me the full antigen sequences? (For the two antibodies in the subject line, not HAT1!) Wich one would you recommend for WB analysis?
    What discount can you offer if I purchase 2-3 vials of each antibody (that is 4-6 vials in total) to test. If one of them works well I will probably need approximately 40 vials. What kind of discount would I get for that quantity?

    The answer "The full sequence of Human HAT1 as follows:
    >sp"
    is not what I expected.

    Please let me know if it will be possible to get the full antigen sequences for your antibodies ab121264 and ab121265 (Anti-HECW1), which one you would recommend for WB and what kind of discounts you may offer.

    Thanks,

    Read More
    Answer

    Thank very much for your email. First, I would like to apologize as I have no idea why I pasted HAT1 sequence in my email; a totally unrelated antibody because we also take phone calls so maybe there was mix up. I apologize for any inconvenience.
    The immunogen sequence as we know is from amino acid 356-481 for ab121265 and from amino acid 500-614 for ab121264. We unfortunately can not disclose the exact sequence which is a proprietary information; we however can fully guarantee that the antibodies will detect the target protein in applications (IHC-P and ICC/IF) and species (human) as listed on the datasheet.
    WB unfortunately is an untested application for both of these antibodies however because both of these antibodies are tested in IHC-P which involves denaturation of antigens like WB so it is more likely that both antibodies, would be suitable. If you are interested in using these I can provide you 100% Abreview discount codes. The discount codes will be worth the price for these antibodies which mean if you buy these antibodies and submit WB Abreviews, irrespective of positive or negative you can get next purchase of two antibodies totally free of charge.
    Full terms and conditions can be found at the following link;

    https://www.abcam.com/index.html?pageconfig=resource&rid=11998&viapagetrap=collaborationdiscount

    I hope this info will be helpful. Should you have any question please do not hesitate to contact me.

    Read More

    Question

    Thanks for your answer.

    Would it be possible for you to send me the full antigen sequence? Wich one would you recommend for WB analysis?

    What discount can you offer if I purchase 2-3 vials of each antibody (that is 4-6 vials in total) to test. If one of them works well I will probably need approximately 40 vials. What kind of discount would I get for that quantity?

    Thanks,

    Read More
    Answer

    Thank you for contacting us.
    The full sequence of Human HAT1 as follows:
    >sp|O14929|HAT1_HUMAN Histone acetyltransferase type B catalytic subunit OS=Homo sapiens GN=HAT1 PE=1 SV=1
    MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLF
    GDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFC
    TNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQT
    FLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQ
    MLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCF
    SREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLI
    SPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
    http://www.uniprot.org/uniprot/O14929
    We always run promotions in different countries e.g. 4 for 3. Could you let me know which country you belong to, I will then tell you if the special price promotion is running or not?
    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.
    Use our products? Submit an Abreview. Earn rewards!
    https://www.abcam.com/abreviews

    Read More

    Question

    What is the difference between your two antibodies for HECW1, product numbers ab121264 and ab121265?
    Can I get a discount if I order several vials at the same time?
    Best regards,

    Read More
    Answer

    Thank you for contacting us.
    The main difference between the two is Immunogen. The immunogen of ab12164 corresponds to amino acid 500-614 and for ab121265 is from aa 356-481.
    The other difference is conc. of antibodies.
    I am glad to hear that you are willing to order several vial. The discount will depend on the number of vial you order so could you tell us how many vials you would like to purchase?
    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com