Overview

  • Product name

  • Description

    Rabbit polyclonal to NEDL2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human NEDL2 aa 495-641.
    Sequence:

    SRADDGSLTSQTKLEDNPVENEEASTHEAASFEDKPENLPELAESSLPAG PAPEEGEGGPEPQPSADQGSAELCGSQEVDQPTSGADTGTSDASGGSRRA VSETESLDQGSEPSQVSSETEPSDPARTESVSEASTRPEGESDLECA


    Database link: Q9P2P5

  • Positive control

    • IHC-P: Human glioma and brain tissue. ICC/IF: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.
ICC/IF 1/50 - 1/200.

Target

  • Function

    E3 ubiquitin-protein ligase that mediates ubiquitination of TP73. Acts to stabilize TP73 and enhance activation of transcription by TP73.
  • Tissue specificity

    Predominantly expressed in adult brain, lung and heart.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 C2 domain.
    Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.
    Contains 2 WW domains.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • C2 and WW domain-containing protein 2 antibody
    • E3 ubiquitin protein ligase HECW2 antibody
    • E3 ubiquitin-protein ligase HECW2 antibody
    • HECT antibody
    • HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2 antibody
    • Hecw2 antibody
    • HECW2_HUMAN antibody
    • KIAA130 antibody
    • KIAA1301 antibody
    • NEDD4 like E3 ubiquitin protein ligase 2 antibody
    • NEDD4 Related E3 Ubiquitin Ligase antibody
    • NEDD4-like E3 ubiquitin-protein ligase 2 antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for NEDL2 using ab236784 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

     

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized A549 (human lung carcinoma cell line) cells labeling NEDL2 (green) using ab236784 at 1/166 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

  • Paraffin-embedded human glioma tissue stained for NEDL2 using ab236784 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab236784 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236784.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up