Overview

  • Product name

  • Description

    Rabbit polyclonal to NEIL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human NEIL1 aa 2-390.
    Sequence:

    PEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASA RGKELRLILSPLPGAQPQQEPLALVFRFGMSGSFQLVPREELPRHAHLRF YTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGPCVLQEYQQFRENVLRN LADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEAL QQHRPSPELTLSQKIRTKLQNPDLLELCHSVPKEVVQLGGKGYGSESGEE DFAAFRAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAPKGRKSRKKKSK ATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPEA PTVPKKGRRKGRQAASGHCRPRKVKADIPSLEPEGTSAS


    Database link: Q96FI4

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.1% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192517 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 44 kDa.
IHC-P Use at an assay dependent concentration.

Target

  • Function

    Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized pyrimidines, such as thymine glycol, formamidopyrimidine (Fapy) and 5-hydroxyuracil. Has marginal activity towards 8-oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Has DNA glycosylase/lyase activity towards mismatched uracil and thymine, in particular in U:C and T:C mismatches.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the FPG family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DNA (apurinic or apyrimidinic site) lyase Neil1 antibody
    • DNA glycosylase/AP lyase Neil 1 antibody
    • DNA glycosylase/AP lyase Neil1 antibody
    • DNA-(apurinic or apyrimidinic site) lyase Neil1 antibody
    • Endonuclease 8 like 1 antibody
    • Endonuclease 8-like 1 antibody
    • Endonuclease VIII antibody
    • Endonuclease VIII like 1 antibody
    • Endonuclease VIII-like 1 antibody
    • FLJ22402 antibody
    • FPG1 antibody
    • hFPG1 antibody
    • NEH 1 antibody
    • NEH1 antibody
    • NEI 1 antibody
    • Nei endonuclease VIII like 1 (E. coli) antibody
    • Nei endonuclease VIII like 1 antibody
    • Nei homolog 1 antibody
    • Nei like 1 antibody
    • Nei like protein 1 antibody
    • Nei-like protein 1 antibody
    • NEI1 antibody
    • NEIL 1 antibody
    • Neil1 antibody
    • NEIL1_HUMAN antibody
    see all

References

ab192517 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Mouse Cell lysate - whole cell (mouse embryonic stem cells)
Gel Running Conditions
Reduced Denaturing (12% gel)
Loading amount
100 µg
Specification
mouse embryonic stem cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Feb 15 2017

Application
Western blot
Sample
Mouse Tissue lysate - nuclear (lung)
Gel Running Conditions
Reduced Denaturing (4-20%)
Loading amount
15 µg
Specification
lung
Blocking step
Milk as blocking agent for 5 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Dec 12 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up