Overview

  • Product name

  • Description

    Rabbit polyclonal to NEK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NEK1 aa 618-710.
    Sequence:

    VLKEQLERKRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSK QQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKR


    Database link: Q96PY6

  • Positive control

    • Human breast tissue and U-251 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab186519 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    Phosphorylates serines and threonines, but also appears to possess tyrosine kinase activity. Implicated in the control of meiosis (By similarity). Involved in cilium assembly. In response to injury that includes DNA damage, NEK1 phosphorylates VDAC1 to limit mitochondrial cell death.
  • Tissue specificity

    High fetal expression in the brain and kidney.
  • Involvement in disease

    Short-rib thoracic dysplasia 6 with or without polydactyly
  • Sequence similarities

    Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Associated with the pericentriolar material. Localizes to centrosome during interphase and mitosis (By similarity).
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp686D06121 antibody
    • DKFZp686K12169 antibody
    • kat antibody
    • KIAA1901 antibody
    • MGC138800 antibody
    • MGC189817 antibody
    • NEK1 antibody
    • NEK1_HUMAN antibody
    • Never in mitosis A-related kinase 1 antibody
    • Never in mitosis gene A-related kinase 1 antibody
    • NIMA (never in mitosis gene a)-related kinase 1 antibody
    • NIMA-related kinase 1 antibody
    • NimA-related protein kinase 1 antibody
    • NY-REN-55 antibody
    • OTTHUMP00000219432 antibody
    • OTTHUMP00000219433 antibody
    • OTTHUMP00000219434 antibody
    • OTTHUMP00000219435 antibody
    • Protein-serine/threonine kinase antibody
    • Renal carcinoma antigen NY-REN-55 antibody
    • Serine/threonine-protein kinase Nek1 antibody
    • SRPS2 antibody
    • SRPS2A antibody
    • SRTD6 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human breast tissue, labeling NEK1 using ab186519 at a 1/200 dilution.

  • Immunofluorescence analysis of PFA/Triton X-100-fixed U-251 cells, labeling NEK1 using ab186519 at 4 µg/ml.

References

ab186519 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186519.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up