Overview

  • Product name

    Anti-NEK6 antibody [OTI2H7]
    See all NEK6 primary antibodies
  • Description

    Mouse monoclonal [OTI2H7] to NEK6
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human NEK6 aa 1-313.
    Sequence:

    MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKK IGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQL NHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVW KYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSE TTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGD KMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVH QVAKQMHIWMSST


    Database link: Q9HC98

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY NEK6 cDNA. IHC-P: Human breast adenocarcinoma, kidney carcinoma, ovary, ovary adenocarcinoma, thyroid carcinoma and endometrium tissues.
  • General notes

    Clone OTI2H7 (formerly 2H7).

Properties

Applications

Our Abpromise guarantee covers the use of ab117986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 36 kDa.
IHC-P 1/50.

Target

  • Function

    Activated during M phase. Required for chromosome segregation at metaphase-anaphase transition and therefore for mitotic progression. Inhibition of activity results in apoptosis. Phosphorylates KIF11 to promote mitotic spindle formation.
  • Tissue specificity

    Ubiquitous, with highest expression in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Highly similar to cell cycle protein kinase CDC5/MSD2 antibody
    • NEK6 antibody
    • NEK6_HUMAN antibody
    • Never in mitosis A-related kinase 6 antibody
    • NIMA (Never In Mitosis Gene A) Related Kinase 6 antibody
    • NimA related protein kinase 6 antibody
    • NimA-related protein kinase 6 antibody
    • Protein kinase SID6 1512 antibody
    • Protein kinase SID6-1512 antibody
    • Putative serine threonine protein kinase antibody
    • Serine/threonine protein kinase Nek6 antibody
    • Serine/threonine-protein kinase Nek6 antibody
    • SID6 1512 antibody
    • SID61512 antibody
    see all

Images

  • All lanes : Anti-NEK6 antibody [OTI2H7] (ab117986) at 1/1000 dilution

    Lane 1 : HEK293T cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK293T cell lysate transfected with pCMV6-ENTRY NEK6 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 36 kDa



    HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC203609)
  • ab117986, at 1/50 dilution, staining NEK6 in paraffin-embedded Human breast adenocarcinoma tissue by Immunohistochemistry.
  • ab117986, at 1/50 dilution, staining NEK6 in paraffin-embedded Human kidney carcinoma tissue by Immunohistochemistry.
  • ab117986, at 1/50 dilution, staining NEK6 in paraffin-embedded Human ovary tissue by Immunohistochemistry.
  • ab117986, at 1/50 dilution, staining NEK6 in paraffin-embedded Human ovary adenocarcinoma tissue by Immunohistochemistry.
  • ab117986, at 1/50 dilution, staining NEK6 in paraffin-embedded Human thyroid carcinoma tissue by Immunohistochemistry.
  • ab117986, at 1/50 dilution, staining NEK6 in paraffin-embedded Human endometrium tissue by Immunohistochemistry.

References

ab117986 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117986.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up