Overview

  • Product name
  • Description
    Rabbit polyclonal to NEK8
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human NEK8 aa 1-692.
    Sequence:

    MEKYERIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKEERQAAQN ECQVLKLLNHPNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLL EEETILHFFVQILLALHHVHTHLILHRDLKTQNILLDKHRMVVKIGDFGI SKILSSKSKAYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLK RAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLSLEPAQRPPLS HIMAQPLCIRALLNLHTDVGSVRMRRAEKSVAPSNTGSRTTSVRCRGIPR GPVRPAIPPPLSSVYAWGGGLGTPLRLPMLNTEVVQVAAGRTQKAGVTRS GRLILWEAPPLGAGGGSLLPGAVEQPQPQFISRFLEGQSGVTIKHVACGD FFTACLTDRGIIMTFGSGSNGCLGHGSLTDISQPTIVEALLGYEMVQVAC GASHVLALSTERELFAWGRGDSGRLGLGTRESHSCPQQVPMPPGQEAQRV VCGIDSSMILTVPGQALACGSNRFNKLGLDHLSLGEEPVPHQQVEEALSF TLLGSAPLDQEPLLSIDLGTAHSAAVTASGDCYTFGSNQHGQLGTNTRRG SRAPCKVQGLEGIKMAMVACGDAFTVAIGAESEVYSWGKGARGRLGRRDE DAGLPRPVQLDETHPYTVTSVSCCHGNTLLAVRSVTDEPVPP


    Database link: Q86SG6

  • Positive control
    • 293T, MCF-7, HeLa, Jurkat, V251, A549, K562, liver and testis lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab175320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 75 kDa.

Target

  • Function
    Required for renal tubular integrity.
  • Tissue specificity
    Highest expression in thyroid, adrenal gland and skin. Low levels in spleen, colon and uterus. Overexpressed in breast tumors, with highest expression in infiltrating ductal carcinomas and moderate levels in mucinous adenocarcinoma.
  • Sequence similarities
    Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
    Contains 1 protein kinase domain.
    Contains 5 RCC1 repeats.
  • Cellular localization
    Cytoplasm. Predominantly cytoplasmic.
  • Information by UniProt
  • Database links
  • Alternative names
    • JCK antibody
    • NEK 8 antibody
    • NEK12A antibody
    • NEK8 antibody
    • NEK8_HUMAN antibody
    • Nephrocystin 9 antibody
    • Never in mitosis A-related kinase 8 antibody
    • NIMA (never in mitosis gene a) related kinase 8 antibody
    • NIMA related kinase 8 antibody
    • NIMA-family kinase NEK8 antibody
    • NIMA-related kinase 12a antibody
    • Nima-related protein kinase 12a antibody
    • NimA-related protein kinase 8 antibody
    • NPHP9 antibody
    • Serine/threonine-protein kinase Nek8 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells labeling NEK8 with ab175320 (shown in green) at a dilution of 1/50. Nuclear DNA was labelled with DAPI (shown in blue).

References

ab175320 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up