Overview

  • Product name

  • Description

    Rabbit polyclonal to NEK9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human NEK9 aa 821-979.
    Sequence:

    FIPMPDSPSPLSAAFSESEKDTLPYEELQGLKVASEAPLEHKPQVEASSP RLNPAVTCAGKGTPLTPPACACSSLQVEVERLQGLVLKCLAEQQKLQQEN LQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKPDLDSDSWCLL GTDSCRPSL


    Database link: Q8TD19

  • Positive control

    • WB: HeLa whole cell lysate; Rat kidney tissue lysate. IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 107 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Pleiotropic regulator of mitotic progression, participating in the control of spindle dynamics and chromosome separation. Phosphorylates different histones, myelin basic protein, beta-casein, and BICD2. Phosphorylates histone H3 on serine and threonine residues and beta-casein on serine residues. Important for G1/S transition and S phase progression.
  • Tissue specificity

    Most abundant in heart, liver, kidney and testis. Also expressed in smooth muscle cells and fibroblasts.
  • Sequence similarities

    Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.
    Contains 1 protein kinase domain.
    Contains 6 RCC1 repeats.
  • Developmental stage

    Expression varied mildly across the cell cycle, with highest expression observed in G1 and stationary-phase cells.
  • Domain

    Dimerizes through its coiled-coil domain.
  • Post-translational
    modifications

    Autophosphorylated on serine and threonine residues. When complexed with FACT, exhibits markedly elevated phosphorylation on Thr-210. During mitosis, not phosphorylated on Thr-210. Phosphorylated by CDK1 in vitro.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA1995 antibody
    • APUG antibody
    • DKFZp434D0935 antibody
    • LCCS10 antibody
    • MGC138306 antibody
    • MGC16714 antibody
    • NC antibody
    • NEK 9 antibody
    • Nek8 antibody
    • nek9 antibody
    • NEK9_HUMAN antibody
    • Nercc 1 kinase antibody
    • NERCC antibody
    • NERCC1 antibody
    • Nercc1 kinase antibody
    • Never in mitosis A related kinase 9 antibody
    • Never in mitosis A-related kinase 9 antibody
    • NIMA (never in mitosis gene a) related kinase 9 antibody
    • NIMA related kinase 8 antibody
    • NIMA related kinase 9 antibody
    • NIMA related kinase Nek8 antibody
    • NimA related protein kinase 9 antibody
    • NIMA-related kinase 8 antibody
    • NimA-related protein kinase 9 antibody
    • Serine/threonine protein kinase Nek9 antibody
    • Serine/threonine-protein kinase Nek9 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for NEK9 using ab235052 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-NEK9 antibody (ab235052) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 107 kDa

References

ab235052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up