Overview

  • Product name

  • Description

    Rabbit polyclonal to NELF-B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ChIP, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human NELF-B aa 8-199.
    Sequence:

    LGVANGEDLKETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTP RLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMP SLQPVVMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALF GDEVSPLLKQYILEKESALFSTELSVLHNFFSPSPKTRRQGE


    Database link: Q8WX92

  • Positive control

    • WB: NIH/3T3, HL-60, EC109 and HEK-293T whole cell lysates. IHC-P: Human endometrial cancer and colon cancer tissues. ChIP: HeLa cells.
  • General notes

    Previously labelled as COBRA1. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237027 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ChIP Use at an assay dependent concentration.

Use 4 µg for 1.1 x 106 cells.

IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000.

Target

  • Relevance

    NELF-B is an essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex causes transcriptional pausing and is counteracted by the P-TEFb kinase complex. It may be able to induce chromatin unfolding.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • A730008L03Rik antibody
    • AB041607 antibody
    • AI663983 antibody
    • Cobra1 antibody
    • Cofactor of BRCA1 antibody
    • DKFZp586B0519 antibody
    • KIAA1182 antibody
    • Negative elongation factor B antibody
    • Negative elongation factor protein B antibody
    • Nelf b antibody
    • NELF-B antibody
    • NELFB antibody
    • RGD1307832 antibody
    • RP13-122B23.3 antibody
    • RP23-132N23.4 antibody
    see all

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) (1.1 x 106) were cross-linked with formaldehyde, sonicated, and immunoprecipitated with 4 µg ab237027 or a control normal rabbit IgG. The resulting ChIP DNA was quantified tissue using real-time PCR with primers against the TFF1 promoter.

  • Paraffin-embedded human colon cancer tissue stained for NELF-B with ab237027 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-NELF-B antibody (ab237027) at 1/1000 dilution

    Lane 1 : EC109 whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/15000 dilution
  • All lanes : Anti-NELF-B antibody (ab237027) at 1/1000 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
    Lane 2 : HL-60 (human promyelocytic leukemia cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/150000 dilution
  • Paraffin-embedded human endometrial cancer tissue stained for NELF-B with ab237027 at 1/100 dilution in immunohistochemical analysis.

References

ab237027 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237027.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up