Overview

  • Product name

  • Description

    Rabbit polyclonal to NELL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human NELL1 aa 185-402. (BC069674).
    Sequence:

    GINLWLGQRNQKHGLFKGIIQDGKIIFMPNGYITQCPNLNHTCPTCSDFL SLVQGIMDLQELLAKMTAKLNYAETRLSQLENCHCEKTCQVSGLLYRDQD SWVDGDHCRNCTCKSGAVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPK CIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQ CCRVCRGHNFCAEGPKCG


    Database link: Q92832

  • Positive control

    • HEK293 cell lysate; Human colon carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab197315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 90 kDa.
IHC-P 1/100 - 1/500.

Target

Images

  • Anti-NELL1 antibody (ab197315) at 1/500 dilution + HEK293 cell lysate

    Predicted band size: 90 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon carcinoma tissue labeling NELL1 with ab197315 at 1/100 dilution.

References

This product has been referenced in:

  • Chen H  et al. miR-27a protects human mitral valve interstitial cell from TNF-a-induced inflammatory injury via up-regulation of NELL-1. Braz J Med Biol Res 51:e6997 (2018). Read more (PubMed: 29694513) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up