Overview

  • Product name

  • Description

    Rabbit polyclonal to NELL2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NELL2 aa 268-349.
    Sequence:

    CYCERTCTMKGTTYREFESWIDGCKNCTCLNGTIQCETLICPNPDCPLKS ALAYVDGKCCKECKSICQFQGRTYFEGERNTV


    Database link: Q9Y266

  • Positive control

    • ICC/IF: HEK-293 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab240780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Sequence similarities

    Contains 6 EGF-like domains.
    Contains 1 TSP N-terminal (TSPN) domain.
    Contains 5 VWFC domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • A330108N19Rik antibody
    • Mel91 antibody
    • MEL91 protein antibody
    • NEL like 2 (chicken) antibody
    • NEL-like protein 2 antibody
    • Nel-related protein 2 antibody
    • NELL2 antibody
    • NELL2_HUMAN antibody
    • Neural epidermal growth factor like 2 antibody
    • NRP2 antibody
    • Protein kinase C-binding protein NELL2 antibody
    • R75516 antibody
    see all

Images

  • Paraformaldehyde-fixed, Triton X-100  permeabilized HEK-293 (human epithelial cell line from embryonic kidney) cells stained for NELL2 (green) using ab240780 at 4 μg/mL in ICC/IF analysis. Staining in vesicles is observed.

References

ab240780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab240780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up