Overview

  • Product name

    Anti-Nephrin antibody [C8]
    See all Nephrin primary antibodies
  • Description

    Mouse monoclonal [C8] to Nephrin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Nephrin aa 1160-1241. N-terminal His and GST tag (Expressed in E.coli).
    Sequence:

    RGFTGEDEDMAFPGHLYDEVERTYPPSGAWGPLYDEVQMGPWDLHWPEDT YQDPRGIYDQVAGDLDTLEPDSLPFELRGHLV


    Database link: O60500

  • Positive control

    • WB: HEK-293T cell lysate. IHC-P: Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    C8
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239476 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 135 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Seems to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion.
  • Tissue specificity

    Specifically expressed in podocytes of kidney glomeruli.
  • Involvement in disease

    Defects in NPHS1 are the cause of nephrotic syndrome type 1 (NPHS1) [MIM:256300]; also known as Finnish congenital nephrosis (CNF). A renal disease characterized clinically by proteinuria, hypoalbuminemia, hyperlipidemia, and edema. Kidney biopsies show non-specific histologic changes such as focal segmental glomerulosclerosis and diffuse mesangial proliferation. Some affected individuals have an inherited steroid-resistant form and progress to end-stage renal failure.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily.
    Contains 1 fibronectin type-III domain.
    Contains 8 Ig-like C2-type (immunoglobulin-like) domains.
  • Developmental stage

    In 23-week-old embryo found in epithelial podocytes of the periphery of mature and developing glomeruli.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues.
  • Cellular localization

    Cell membrane. Predominantly located at podocyte slit diaphragm between podocyte foot processes. Also associated with podocyte apical plasma membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CNF antibody
    • Nephrin antibody
    • Nephrosis 1 congenital Finnish type antibody
    • Nephrosis 1, congenital, Finnish type (nephrin) antibody
    • NPHN antibody
    • NPHN_HUMAN antibody
    • NPHS 1 antibody
    • Nphs1 antibody
    • Renal glomerulus specific cell adhesion receptor antibody
    • Renal glomerulus-specific cell adhesion receptor antibody
    see all

Images

  • Anti-Nephrin antibody [C8] (ab239476) at 1 µg/ml + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Predicted band size: 135 kDa

  • Paraffin-embedded human kidney tissue stained for Nephrin using ab239476 at 30 μg/ml in immunohistochemical analysis. DAB staining.

References

ab239476 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239476.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up