Overview

  • Product name

  • Description

    Rabbit polyclonal to Nesprin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Nesprin 2 aa 4204-4341.
    Sequence:

    GTTPPIEADTLDSSDAQGGLEPRVEKTRPEPTEVLHACKTQVAELELWLQ QANVAVEPETLNADMQQVLEQQLVGCQAMLTEIEHKVAFLLETCKDQGLG DNGATQHEAEALSLKLKTVKCNLEKVQMMLQEKHSEDQ


    Database link: Q8WXH0

  • Positive control

    • Human kidney tissue. MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204308 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Multi-isomeric modular protein which forms a linking network between organelles and the actin cytoskeleton to maintain the subcellular spatial organization. Component of SUN-protein-containing multivariate complexes also called LINC complexes which link the nucleoskeleton and cytoskeleton by providing versatile outer nuclear membrane attachment sites for cytoskeletal filaments. Involved in the maintenance of nuclear organization and structural integrity. Connects nuclei to the cytoskeleton by interacting with the nuclear envelope and with F-actin in the cytoplasm. Specifically, SYNE2 and SUN2 assemble in arrays of transmembrane actin-associated nuclear (TAN) lines which are bound to F-actin cables and couple the nucleus to retrograde actin flow during actin-dependent nuclear movement. Required for centrosome migration to the apical cell surface during early ciliogenesis.
  • Tissue specificity

    Widely expressed, with higher level in kidney, adult and fetal liver, stomach and placenta. Weakly expressed in skeletal muscle and brain. Isoform 5 is highly expressed in pancreas, skeletal muscle and heart.
  • Involvement in disease

    Defects in SYNE2 are the cause of Emery-Dreifuss muscular dystrophy type 5 (EDMD5) [MIM:612999]. A degenerative myopathy characterized by weakness and atrophy of muscle without involvement of the nervous system, early contractures of the elbows, Achilles tendons and spine, and cardiomyopathy associated with cardiac conduction defects.
  • Sequence similarities

    Belongs to the nesprin family.
    Contains 1 actin-binding domain.
    Contains 2 CH (calponin-homology) domains.
    Contains 1 KASH domain.
    Contains 9 spectrin repeats.
  • Domain

    The KASH domain mediates the nuclear envelope targeting.
  • Cellular localization

    Nucleus outer membrane. Sarcoplasmic reticulum membrane. Cell membrane. Cytoplasm > cytoskeleton. Mitochondrion. Nucleus > nucleoplasm. Different isoform patterns are found in the different compartments of the cell. The isoforms having the C-terminal transmembrane span can be found in several organellar membranes like the nuclear envelope, the sarcoplasmic reticulum of myoblasts, or the lamellipodia and focal adhesions at the cell membrane. The largest part of the outer nuclear membrane-associated protein is cytoplasmic, while its C-terminal part is associated with the nuclear envelope, most probably the outer nuclear membrane. Remains associated with the nuclear envelope during its breakdown in mitotic cells. Shorter solubles isoforms can be found in the cytoplasm and within the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZP434H2235 antibody
    • DKFZp686E01115 antibody
    • DKFZp686H1931 antibody
    • FLJ11014 antibody
    • FLJ43727 antibody
    • FLJ45710 antibody
    • FLJ46790 antibody
    • KIAA1011 antibody
    • Nesprin-2 antibody
    • Nesprin2 antibody
    • NUA antibody
    • NUANCE antibody
    • Nuclear envelope spectrin repeat protein 2 antibody
    • Nucleus and actin connecting element antibody
    • Nucleus and actin connecting element protein antibody
    • Protein NUANCE antibody
    • Spectrin repeat containing nuclear envelope 2 antibody
    • Synaptic nuclear envelope protein 2 antibody
    • Synaptic nuclei expressed gene 2 antibody
    • SYNE 2 antibody
    • Syne-2 antibody
    • SYNE2 antibody
    • SYNE2_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of MCF7 cells (PFA-fixed/Triton X-100 permeabilized) labeling Nesprin 2 with ab204308 at 4 µg/mL.

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling Nesprin 2 with ab204308 at 1/500 dilution.

References

ab204308 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Human Tissue sections (Abdominal Skin)
Permeabilization
Yes - 0.1% Triton X-100
Specification
Abdominal Skin
Blocking step
1% BSA, 2% FBS, 10% Goat Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 20°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Aug 04 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up