Overview

  • Product name

    Anti-NEU2 antibody
  • Description

    Rabbit polyclonal to NEU2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NEU2 aa 171-380.
    Sequence:

    ARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQ VAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQ GCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAYLNPRPPAPEA WSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLK QAFPAEYLPQ


    Database link: Q9Y3R4

  • Positive control

    • IHC-P: Human adrenal gland tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Hydrolyzes sialylated compounds.
  • Tissue specificity

    Expressed in skeletal muscle, fetal liver and embryonic carcinoma cell line NT2D1.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 33 family.
    Contains 2 BNR repeats.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytosolic sialidase antibody
    • MGC129579 antibody
    • N acetyl alpha neuraminidase 2 antibody
    • N-acetyl-alpha-neuraminidase 2 antibody
    • Neu2 antibody
    • NEUR2_HUMAN antibody
    • Neuraminidase 2 antibody
    • OTTHUMP00000164374 antibody
    • SIAL2 antibody
    • Sialidase 2 antibody
    • Sialidase-2 antibody
    see all

Images

  • Paraffin-embedded human adrenal gland tissue stained for NEU2 using ab234715 at 1/100 dilution in immunohistochemical analysis.

References

ab234715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up