Overview

  • Product name

    Anti-Neuraminidase antibody
    See all Neuraminidase primary antibodies
  • Description

    Rabbit polyclonal to Neuraminidase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Guinea pig, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Neuraminidase aa 156-415.
    Sequence:

    SLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQ KQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPK QENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPR DVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTS WRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESIS VAKISVYGTL


    Database link: Q99519

  • Positive control

    • WB: Mouse liver tissue extract; rat liver tissue extract. IHC-P: Human adrenal tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230526 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 45 kDa.
IHC-P 1/100.

Target

  • Function

    Catalyzes the removal of sialic acid (N-acetylneuramic acid) moities from glycoproteins and glycolipids. To be active, it is strictly dependent on its presence in the multienzyme complex. Appears to have a preference for alpha 2-3 and alpha 2-6 sialyl linkage.
  • Tissue specificity

    Highly expressed in pancreas, followed by skeletal muscle, kidney, placenta, heart, lung and liver. Weakly expressed in brain.
  • Involvement in disease

    Defects in NEU1 are the cause of sialidosis (SIALIDOSIS) [MIM:256550]. It is a lysosomal storage disease occurring as two types with various manifestations. Type 1 sialidosis (cherry red spot-myoclonus syndrome or normosomatic type) is late-onset and it is characterized by the formation of cherry red macular spots in childhood, progressive debilitating myoclonus, insiduous visual loss and rarely ataxia. The diagnosis can be confirmed by the screening of the urine for sialyloligosaccharides. Type 2 sialidosis (also known as dysmorphic type) occurs as several variants of increasing severity with earlier age of onset. It is characterized by the presence of abnormal somatic features including coarse facies and dysostosis multiplex, vertebral deformities, mental retardation, cherry-red spot/myoclonus, sialuria, cytoplasmic vacuolation of peripheral lymphocytes, bone marrow cells and conjunctival epithelial cells.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 33 family.
    Contains 4 BNR repeats.
  • Domain

    A C-terminal internalization signal (YGTL) appears to allow the targeting of plasma membrane proteins to endosomes.
  • Post-translational
    modifications

    N-glycosylated.
    Phosphorylation of tyrosine within the internalization signal results in inhibition of sialidase internalization and blockage on the plasma membrane.
  • Cellular localization

    Lysosome membrane. Lysosome lumen. Cell membrane. Cytoplasmic vesicle. Localized not only on the inner side of the lysosomal membrane and in the lysosomal lumen, but also on the plasma membrane and in intracellular vesicles.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acetylneuraminyl hydrolase antibody
    • exo-alpha-sialidase antibody
    • G9 sialidase antibody
    • Lysosomal sialidase antibody
    • N acetyl alpha neuraminidase 1 antibody
    • N-acetyl-alpha-neuraminidase 1 antibody
    • NANH antibody
    • NEU antibody
    • NEU1 antibody
    • NEUR1_HUMAN antibody
    • Neuraminidase 1 antibody
    • Neuraminidase antibody
    • SIAL1 antibody
    • sialidase 1 (lysosomal sialidase) antibody
    • Sialidase 1 antibody
    • Sialidase, lysosomal antibody
    • Sialidase-1 antibody
    see all

Images

  • All lanes : Anti-Neuraminidase antibody (ab230526) at 1/500 dilution

    Lane 1 : Mouse liver tissue extract
    Lane 2 : Rat liver tissue extract

    Developed using the ECL technique.

    Predicted band size: 45 kDa

  • Formalin-fixed, paraffin-embedded human adrenal tissue stained for Neuraminidase with ab230526 at 1/100 dilution in immunohistochemical analysis.

     

References

ab230526 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230526.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up