Overview

  • Product name

    Anti-Neuraminidase antibody
    See all Neuraminidase primary antibodies
  • Description

    Rabbit polyclonal to Neuraminidase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Pig, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Neuraminidase aa 47-415. Two N-terminal tags His-tag and S-tag, (Expressed in .coli).
    Sequence:

    AENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEA RKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDV ETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVF APGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGV SGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSY DACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTL RWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKG RNHYTESISVAKISVYGTL


    Database link: Q99519

  • Positive control

    • IHC-P: Human stomach and liver tissue. WB: Recombinant human Neuraminidase protein; Human liver lysate; HepG2 whole cell lysate (ab7900); Mouse pancreas lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab233119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 45 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Catalyzes the removal of sialic acid (N-acetylneuramic acid) moities from glycoproteins and glycolipids. To be active, it is strictly dependent on its presence in the multienzyme complex. Appears to have a preference for alpha 2-3 and alpha 2-6 sialyl linkage.
  • Tissue specificity

    Highly expressed in pancreas, followed by skeletal muscle, kidney, placenta, heart, lung and liver. Weakly expressed in brain.
  • Involvement in disease

    Defects in NEU1 are the cause of sialidosis (SIALIDOSIS) [MIM:256550]. It is a lysosomal storage disease occurring as two types with various manifestations. Type 1 sialidosis (cherry red spot-myoclonus syndrome or normosomatic type) is late-onset and it is characterized by the formation of cherry red macular spots in childhood, progressive debilitating myoclonus, insiduous visual loss and rarely ataxia. The diagnosis can be confirmed by the screening of the urine for sialyloligosaccharides. Type 2 sialidosis (also known as dysmorphic type) occurs as several variants of increasing severity with earlier age of onset. It is characterized by the presence of abnormal somatic features including coarse facies and dysostosis multiplex, vertebral deformities, mental retardation, cherry-red spot/myoclonus, sialuria, cytoplasmic vacuolation of peripheral lymphocytes, bone marrow cells and conjunctival epithelial cells.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 33 family.
    Contains 4 BNR repeats.
  • Domain

    A C-terminal internalization signal (YGTL) appears to allow the targeting of plasma membrane proteins to endosomes.
  • Post-translational
    modifications

    N-glycosylated.
    Phosphorylation of tyrosine within the internalization signal results in inhibition of sialidase internalization and blockage on the plasma membrane.
  • Cellular localization

    Lysosome membrane. Lysosome lumen. Cell membrane. Cytoplasmic vesicle. Localized not only on the inner side of the lysosomal membrane and in the lysosomal lumen, but also on the plasma membrane and in intracellular vesicles.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acetylneuraminyl hydrolase antibody
    • exo-alpha-sialidase antibody
    • G9 sialidase antibody
    • Lysosomal sialidase antibody
    • N acetyl alpha neuraminidase 1 antibody
    • N-acetyl-alpha-neuraminidase 1 antibody
    • NANH antibody
    • NEU antibody
    • NEU1 antibody
    • NEUR1_HUMAN antibody
    • Neuraminidase 1 antibody
    • Neuraminidase antibody
    • SIAL1 antibody
    • sialidase 1 (lysosomal sialidase) antibody
    • Sialidase 1 antibody
    • Sialidase, lysosomal antibody
    • Sialidase-1 antibody
    see all

Images

  • Anti-Neuraminidase antibody (ab233119) at 2 µg/ml + Human liver tissue lysate.

    Predicted band size: 45 kDa

  • Anti-Neuraminidase antibody (ab233119) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate.

    Predicted band size: 45 kDa

  • Anti-Neuraminidase antibody (ab233119) at 2 µg/ml + Recombinant human Neuraminidase protein.

    Predicted band size: 45 kDa

  • Anti-Neuraminidase antibody (ab233119) at 2 µg/ml + Mouse pancreas tissue lysate.

    Predicted band size: 45 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Neuraminidase using ab233119 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for Neuraminidase using ab233119 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for Neuraminidase using ab233119 at 20µg/mL in immunohistochemical analysis. DAB staining.

References

ab233119 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (platelets)
Permeabilization
Yes - 0.05% triton X100
Specification
platelets
Blocking step
BSA as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 21°C
Fixative
Formaldehyde

Dianne Van Der Wal

Verified customer

Submitted Aug 20 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up