Overview

  • Product name

  • Description

    Rabbit polyclonal to Neurexin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Neurexin 1 aa 1219-1398.
    Sequence:

    RSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLS GLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMS TSIMETTTTLATSTARRGKPPTKEPISQTTDDILVASAECPSDDEDIDPC EPSSGGLANPTRAGGREPYPGSAEVIRESS


    Database link: Q9ULB1

  • Positive control

    • ICC/IF: HepG2 cells. WB: Mouse heart and kidney lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab222806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/2000 - 1/5000. Detects a band of approximately 47 kDa (predicted molecular weight: 47 kDa).

Target

  • Function

    Cell surface protein involved in cell-cell-interactions, exocytosis of secretory granules and regulation of signal transmission. Function is isoform-specific. Alpha-type isoforms have a long N-terminus with six laminin G-like domains and play an important role in synaptic signal transmission. Alpha-type isoforms play a role in the regulation of calcium channel activity and Ca(2+)-triggered neurotransmitter release at synapses and at neuromuscular junctions. They play an important role in Ca(2+)-triggered exocytosis of secretory granules in pituitary gland. They may effect their functions at synapses and in endocrine cells via their interactions with proteins from the exocytotic machinery. Likewise, alpha-type isoforms play a role in regulating the activity of postsynaptic NMDA receptors, a subtype of glutamate-gated ion channels. Both alpha-type and beta-type isoforms may play a role in the formation or maintenance of synaptic junctions via their calcium-dependent interactions (via the extracellular domains) with neuroligin family members, CBLN1 or CBLN2. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Alpha-type isoforms were first identified as receptors for alpha-latrotoxin from spider venom.
  • Tissue specificity

    Brain.
  • Sequence similarities

    Belongs to the neurexin family.
    Contains 3 EGF-like domains.
    Contains 6 laminin G-like domains.
  • Post-translational
    modifications

    N-glycosylated.
    O-glycosylated.
  • Cellular localization

    Cell membrane. Cell junction, synapse. Localized on the pre-synaptic membrane.
  • Information by UniProt
  • Database links

  • Form

    The neurexin genes use alternate promoters, splice sites and exons to encode potentially hundreds or thousands of mRNA transcripts.
  • Alternative names

    • DKFZp313P2036 antibody
    • FLJ35941 antibody
    • Hs.22998 antibody
    • KIAA0578 antibody
    • Neurexin 1 alpha antibody
    • Neurexin 1 beta antibody
    • Neurexin I-alpha antibody
    • Neurexin-1 antibody
    • Neurexin-1-alpha antibody
    • NRX1A_HUMAN antibody
    • NRXN1 antibody
    • PTHSL2 antibody
    • SCZD17 antibody
    see all

Images

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Neurexin I beta (green) using ab222806 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • All lanes : Anti-Neurexin 1 antibody (ab222806) at 1/2000 dilution

    Lane 1 : Mouse heart lysate
    Lane 2 : Mouse kidney lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 47 kDa
    Observed band size: 47 kDa

References

ab222806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up