Overview

  • Product name

    Anti-neurobeachin-like 1 antibody
  • Description

    Rabbit polyclonal to neurobeachin-like 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human neurobeachin-like 1 aa 1292-1341 (internal sequence).
    Sequence:

    KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT

  • Positive control

    • WB: MCF7 cell lysate and mouse lung tissue lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab84118 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 151 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    Neurobeachin-like 1 belongs to the WD repeat neurobeachin family. It contains 1 BEACH domain and 2 WD repeats. Neurobeachin-like 1 is highly expressed in brain, kidney, prostate and testis and weakly expressed in ovary, small intestine, colon and peripheral blood leukocytes. It may be correlative to several tumors, such as ovary serous adenocarcinoma and metastasis mammary gland carcinoma breast.
  • Database links

  • Alternative names

    • A530083I02Rik antibody
    • ALS2CR16 antibody
    • ALS2CR17 antibody
    • Amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 16 antibody
    • Amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 17 antibody
    • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 17 protein antibody
    • Beach antibody
    • FLJ26555 antibody
    • MGC164581 antibody
    • MGC168834 antibody
    • NBEAL 1 antibody
    • NBEAL1 antibody
    • Neurobeachin like protein 1 antibody
    • OTTHUMP00000205117 antibody
    see all

Images

  • Anti-neurobeachin-like 1 antibody (ab84118) at 1 µg/ml (in 5% skim milk / PBS buffer) + MCF7 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 151 kDa
    Observed band size: 151 kDa



    Gel concentration: 6-18%
  • Anti-neurobeachin-like 1 antibody (ab84118) at 1 µg/ml + Mouse lung tissue lysate at 25 µg

    Predicted band size: 151 kDa

References

ab84118 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab84118.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up