Overview

  • Product name

    Anti-Neurofilament heavy polypeptide antibody
    See all Neurofilament heavy polypeptide primary antibodies
  • Description

    Rabbit polyclonal to Neurofilament heavy polypeptide
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human Neurofilament heavy polypeptide aa 5-55 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    GGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTS V


    Database link: P12036

  • Positive control

    • IHC-P: Mouse brain, rat brain and spinal cord tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab203039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

When using a fluorescent probe please use dilutions of 1/50 - 1/200.

Target

  • Function

    Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber. NF-H has an important function in mature axons that is not subserved by the two smaller NF proteins.
  • Involvement in disease

    Defects in NEFH are a cause of susceptibility to amyotrophic lateral sclerosis (ALS) [MIM:105400]. ALS is a neurodegenerative disorder affecting upper and lower motor neurons, and resulting in fatal paralysis. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. The etiology is likely to be multifactorial, involving both genetic and environmental factors.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Post-translational
    modifications

    There are a number of repeats of the tripeptide K-S-P, NFH is phosphorylated on a number of the serines in this motif. It is thought that phosphorylation of NFH results in the formation of interfilament cross bridges that are important in the maintenance of axonal caliber.
    Phosphorylation seems to play a major role in the functioning of the larger neurofilament polypeptides (NF-M and NF-H), the levels of phosphorylation being altered developmentally and coincident with a change in the neurofilament function.
    Phosphorylated in the Head and Rod regions by the PKC kinase PKN1, leading to inhibit polymerization.
  • Information by UniProt
  • Database links

  • Alternative names

    • 200 kDa neurofilament protein antibody
    • CMT2CC antibody
    • Nefh antibody
    • Neurofilament heavy polypeptide 200kDa antibody
    • Neurofilament heavy polypeptide antibody
    • Neurofilament triplet H protein antibody
    • NF H antibody
    • NF-H antibody
    • NFH antibody
    • NFH_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse brain tissue, labeling Neurofilament using ab203039 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat spinal cord tissue, labeling Neurofilament using ab203039 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat brain tissue, labeling Neurofilament using ab203039 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203039 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203039.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up