Anti-Neurogenin3/NGN-3 antibody (ab216885)
Key features and details
- Rabbit polyclonal to Neurogenin3/NGN-3
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Neurogenin3/NGN-3 antibody
See all Neurogenin3/NGN-3 primary antibodies -
Description
Rabbit polyclonal to Neurogenin3/NGN-3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat -
Immunogen
Synthetic peptide within Human Neurogenin3/NGN-3 aa 60-110 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
Sequence:KLRARRGGRSRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGV L
Database link: Q9Y4Z2 -
Positive control
- WB: Mouse liver tissue lysate IHC-P: Mouse small intestine tissue.
-
General notes
Previously labelled as Neurogenin3.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab216885 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. | |
WB | 1/300. Predicted molecular weight: 23 kDa. |
Target
-
Function
Involved in neurogenesis. Also required for the specification of a common precursor of the 4 pancreatic endocrine cell types. -
Involvement in disease
Defects in NEUROG3 are the cause of diarrhea type 4 (DIAR4) [MIM:610370]. DIAR4 is a characterized by severe, life-threatening watery diarrhea associated with generalized malabsorption and a paucity of enteroendocrine cells. -
Sequence similarities
Contains 1 basic helix-loop-helix (bHLH) domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 50674 Human
- Entrez Gene: 11925 Mouse
- Entrez Gene: 60329 Rat
- Omim: 604882 Human
- SwissProt: Q9Y4Z2 Human
- SwissProt: P70661 Mouse
- Unigene: 532682 Human
- Unigene: 57236 Mouse
see all -
Alternative names
- ATH4B antibody
- Atoh5 antibody
- bHLHa7 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Neurogenin3/NGN-3 antibody (ab216885)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse small intestine tissue, labeling Neurogenin3/NGN-3 with ab216885 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.
-
Anti-Neurogenin3/NGN-3 antibody (ab216885) at 1/300 dilution + Mouse liver tissue lysate
Predicted band size: 23 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Neurogenin3/NGN-3 antibody (ab216885)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded human breast carcinoma tissue, labeling Neurogenin3/NGN-3 with ab216885 at 1/400 dilution, followed by conjugation to the secondary antibody and DAB staining.
Datasheets and documents
References (1)
ab216885 has been referenced in 1 publication.
- Gao Y et al. Role of TGF-ß/Smad Pathway in the Transcription of Pancreas-Specific Genes During Beta Cell Differentiation. Front Cell Dev Biol 7:351 (2019). PubMed: 31921861