Anti-Neurogenin3/NGN-3 antibody (ab216885)

Submit a review Submit a question References (1)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Neurogenin3/NGN-3 antibody (ab216885)
  • Western blot - Anti-Neurogenin3/NGN-3 antibody (ab216885)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Neurogenin3/NGN-3 antibody (ab216885)

Key features and details

  • Rabbit polyclonal to Neurogenin3/NGN-3
  • Suitable for: IHC-P, WB
  • Reacts with: Mouse, Human
  • Isotype: IgG

Overview

  • Product name

    Anti-Neurogenin3/NGN-3 antibody
    See all Neurogenin3/NGN-3 primary antibodies

  • Description

    Rabbit polyclonal to Neurogenin3/NGN-3

  • Host species

    Rabbit

  • Tested applications

    Suitable for: IHC-P, WBmore details

  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat

  • Immunogen

    Synthetic peptide within Human Neurogenin3/NGN-3 aa 60-110 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    KLRARRGGRSRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGV L


    Database link: Q9Y4Z2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: Mouse liver tissue lysate IHC-P: Mouse small intestine tissue.

  • General notes

    Previously labelled as Neurogenin3.

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab216885 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/300. Predicted molecular weight: 23 kDa.

Target

  • Function

    Involved in neurogenesis. Also required for the specification of a common precursor of the 4 pancreatic endocrine cell types.

  • Involvement in disease

    Defects in NEUROG3 are the cause of diarrhea type 4 (DIAR4) [MIM:610370]. DIAR4 is a characterized by severe, life-threatening watery diarrhea associated with generalized malabsorption and a paucity of enteroendocrine cells.

  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.

  • Cellular localization

    Nucleus.
  • Information by UniProt

  • Database links

    see all

  • Alternative names

    • ATH4B antibody
    • Atoh5 antibody
    • bHLHa7 antibody
    • Class A basic helix-loop-helix protein 7 antibody
    • Math4B antibody
    • NEUROG3 antibody
    • Neurogenin-3 antibody
    • Neurogenin3 antibody
    • NGN-3 antibody
    • ngn3 antibody
    • NGN3_HUMAN antibody
    • OTTHUMP00000019730 antibody
    • Protein atonal homolog 5 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Neurogenin3/NGN-3 antibody (ab216885)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Neurogenin3/NGN-3 antibody (ab216885)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse small intestine tissue, labeling Neurogenin3/NGN-3 with ab216885 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Western blot - Anti-Neurogenin3/NGN-3 antibody (ab216885)
    Western blot - Anti-Neurogenin3/NGN-3 antibody (ab216885)
    Anti-Neurogenin3/NGN-3 antibody (ab216885) at 1/300 dilution + Mouse liver tissue lysate

    Predicted band size: 23 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Neurogenin3/NGN-3 antibody (ab216885)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Neurogenin3/NGN-3 antibody (ab216885)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded human breast carcinoma tissue, labeling Neurogenin3/NGN-3 with ab216885 at 1/400 dilution, followed by conjugation to the secondary antibody and DAB staining.

References (1)

Publishing research using ab216885? Please let us know so that we can cite the reference in this datasheet.

ab216885 has been referenced in 1 publication.

  • Gao Y  et al. Role of TGF-ß/Smad Pathway in the Transcription of Pancreas-Specific Genes During Beta Cell Differentiation. Front Cell Dev Biol 7:351 (2019). PubMed: 31921861

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab216885.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com