Overview

  • Product name

    Anti-Neuroglobin antibody
  • Description

    Rabbit polyclonal to Neuroglobin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Dog, Pig, Chimpanzee, Rhesus monkey
  • Immunogen

    Fusion protein corresponding to Human Neuroglobin aa 1-151. (Full length, BC032509).
    Sequence:

    MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFS SPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVG VKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDG E


    Database link: Q9NPG2

  • Positive control

    • Human liver cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab197670 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/100.

Target

  • Function

    Involved in oxygen transport in the brain. Hexacoordinate globin, displaying competitive binding of oxygen or the distal His residue to the iron atom. Not capable of penetrating cell membranes. The deoxygenated form exhibits nitrite reductase activity inhibiting cellular respiration via NO-binding to cytochrome c oxidase. Involved in neuroprotection during oxidative stress. May exert its anti-apoptotic activity by acting to reset the trigger level of mitochondrial cytochrome c release necessary to commit the cells to apoptosis.
  • Tissue specificity

    Predominantly expressed in brain, the strongest expression is seen in the frontal lobe, the subthalamic nucleus and the thalamus.
  • Sequence similarities

    Belongs to the globin family.
  • Post-translational
    modifications

    A redox disulfide bond regulates the heme pocket coordination and the rate of nitrite reduction to NO.
    Phosphorylated in vitro by ERK1, ERK2 and PKA, and in vivo during hypoxia. Phosphorylation increases nitrite reductase activity.
  • Cellular localization

    Perikaryon. Cytoplasm. Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • Neuroglobin antibody
    • NGB antibody
    • NGB_HUMAN antibody

Images

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling Neuroglobin with ab197670 at 1/20 dilution.

References

ab197670 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197670.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up