Overview

  • Product name

    Anti-Neuroligin 3 antibody [N110/29] (FITC)
    See all Neuroligin 3 primary antibodies
  • Description

    Mouse monoclonal [N110/29] to Neuroligin 3 (FITC)
  • Host species

    Mouse
  • Conjugation

    FITC. Ex: 493nm, Em: 528nm
  • Specificity

    ab186287 does not cross-react with Neuroligin-1, -2 or -4.
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Fr, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Fusion protein corresponding to Rat Neuroligin 3 aa 730-848 (C terminal). (AAA97871).
    Sequence:

    YYRKDKRRQEPLRQPSPQRGTGAPELGTAPEEELAALQLGPTHHECEAGP PHDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLVGLQTLHPYNT FAAGFNSTGLP NSHSTTRV


    Database link: Q62889

  • Positive control

    • Rat brain lysate.
  • General notes

    The clone number has been updated from S110-29 to N110/29, both clone numbers name the same antibody clone.

     

Properties

Applications

Our Abpromise guarantee covers the use of ab186287 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
WB 1/1000. Predicted molecular weight: 94 kDa.
IHC-Fr Use at an assay dependent concentration.
IHC-P Use at an assay dependent concentration.

Target

  • Function

    Cell surface protein involved in cell-cell-interactions via its interactions with neurexin family members. Plays a role in synapse function and synaptic signal transmission, and may mediate its effects by clustering other synaptic proteins. May promote the initial formation of synapses, but is not essential for this. May also play a role in glia-glia or glia-neuron interactions in the developing peripheral nervous system.
  • Tissue specificity

    Expressed in the blood vessel walls (at protein level). Detected in throughout the brain and in spinal cord. Detected in brain, and at lower levels in pancreas islet beta cells.
  • Involvement in disease

    Autism, X-linked 1 (AUTSX1) [MIM:300425]: A complex multifactorial, pervasive developmental disorder characterized by impairments in reciprocal social interaction and communication, restricted and stereotyped patterns of interests and activities, and the presence of developmental abnormalities by 3 years of age. Most individuals with autism also manifest moderate mental retardation. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
    X-linked Asperger syndrome 1 (ASPGX1) [MIM:300494]: Considered to be a form of childhood autism. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
  • Sequence similarities

    Belongs to the type-B carboxylesterase/lipase family.
  • Cellular localization

    Cell membrane. Cell junction > synapse. Detected at both glutamatergic and GABAergic synapses.
  • Information by UniProt
  • Database links

  • Alternative names

    • Gliotactin homolog antibody
    • HNL3 antibody
    • Neuroligin-3 antibody
    • Nlgn3 antibody
    • NLGN3_HUMAN antibody
    see all

References

ab186287 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186287.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up