Overview

  • Product name

    Anti-Neuron navigator 1 antibody [KT124]
  • Description

    Rat monoclonal [KT124] to Neuron navigator 1
  • Host species

    Rat
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Neuron navigator 1 aa 742-1008.
    Sequence:

    KAKAVALDSDNISLKSIGSPESTPKNQASHPTATKLAELPPTPLRATAKS FVKPPSLANLDKVNSNSLDLPSSSDTTHASKVPDLHATSSASGGPLPSCF TPSPAPILNINSASFSQGLELMSGFSVPKETRMYPKLSGLHRSMESLQMP MSLPSAFPSSTPVPTPPAPPAAPTEEETEELTWSGSPRAGQLDSNQRDRN TLPKKGLRYQLQSQEETKERRHSHTIGGLPESDDQSELPSPPALPMSLSA KGQLTNIVSPTAATTPR


    Database link: Q8NEY1

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    ab201920 is purified from culture supernatant using a protein G column.
  • Clonality

    Monoclonal
  • Clone number

    KT124
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201920 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/200 - 1/1000.
WB 1/500 - 1/10000. Predicted molecular weight: 202 kDa.

Target

  • Relevance

    The development of the nervous system (NS) requires the coordinated migration of multiple waves of neurons and subsequent processes of neurite maturation, both involving selective guidance mechanisms. In Caenorhabditis elegans, unc-53 codes for a new multidomain protein involved in the directional migration of a subset of cells. We describe here the first functional characterization of the mouse homologue, mouse Neuron navigator 1 (mNAV1) expression is primarily restricted to the CNS during development. mNAV1 is a microtubules associated protein. The abolition of mNAV1 causes loss of directionality in the leading processes of pontine-migrating cells, providing evidence for a role of mNAV1 in mediating (Netrin1-induced) directional migration.
  • Cellular localization

    Cytoplasm › cytoskeleton. Note: Associates with a subset of microtubule plus ends. Enriched in neuronal growth cone.
  • Database links

  • Alternative names

    • DKFZp781D0314 antibody
    • FLJ12560 antibody
    • FLJ14203 antibody
    • KIAA1151 antibody
    • MGC14961 antibody
    • mNav1 antibody
    • mouse Nav1 antibody
    • Nav 1 antibody
    • Nav1 antibody
    • neuron navigator 1 antibody
    • POMFIL 3 antibody
    • POMFIL3 antibody
    • Pore membrane and/or filament interacting like protein 3 antibody
    • Protein Steerin 1 antibody
    • Protein Steerin1 antibody
    • Steerin 1 antibody
    • Steerin1 antibody
    • unc-53 homolog 1 antibody
    • UNC53H1 antibody
    see all

References

This product has been referenced in:

  • Mendoza-Topaz C  et al. BioID identifies proteins involved in the cell biology of caveolae. PLoS One 13:e0209856 (2018). Read more (PubMed: 30589899) »
  • van Haren J  et al. Dynamic microtubules catalyze formation of navigator-TRIO complexes to regulate neurite extension. Curr Biol 24:1778-85 (2014). Read more (PubMed: 25065758) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201920.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up