Overview

  • Product name

    Anti-Neuropeptide Y antibody
    See all Neuropeptide Y primary antibodies
  • Description

    Sheep polyclonal to Neuropeptide Y
  • Host species

    Sheep
  • Specificity

    The specificity of the NPY antiserum was determined by radioimmunoassay. Synthetic peptides, somatostatin-14, leu-enkephalin, met-enkephalin, oxytocin, Arg8-vasopressin, vasoactive intestinal peptide, angiotensin II demonstrated less than 0.005% cross- reactivity and substance P less than 0.02%. Peptide YY and bovine pancreatic polypeptide demonstrated approx. 36% and 0.05% cross- reactivity respectively. Human peptide YY share 65% homology amino acid sequence for human NPY. Synthetic NPY completely abolished radio labelled NPY binding to NPY antibody in RIA and antibody binding to tissue antigen.
  • Tested applications

    Suitable for: IHC-Fr, ICC/IF, IHC-FoFrmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Rabbit, Guinea pig, Human
  • Immunogen

    Synthetic peptide:

    TPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

    , corresponding to amino acids 30-64 of Human Neuropeptide Y. The peptide was coupled to Bovine Thyroglobulin.

  • Positive control

    • This antibody gave a positive result when used in the following methanol fixed cell lines: SKNSH.
  • General notes

    This antibody is excellent for immunohistochemistry. Good staining was achieved in rabbit brain and guinea pig gastrointestinal tract.

Properties

Applications

Our Abpromise guarantee covers the use of ab6173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr Use at an assay dependent concentration.
ICC/IF 1/100.
IHC-FoFr 1/500. PubMed: 19200078

Target

Images

  • ab6173 staining Neuropeptide Y in rat brain tissue sections by Immunohistochemistry (IHC-Fr - frozen sections). Tissue was fixed with paraformaldehyde, permeabilized with 0.2% Triton X-100 and blocked with 5% serum for 1 hour at room temperature. Samples were incubated with primary antibody (1/10000) for 16 hours at 4°C. A Biotin-conjugated Donkey anti-sheep IgG polyclonal (1/500) was used as the secondary antibody.

    See Abreview

  • ICC/IF image of ab6173 stained SKNSH cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal donkey serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody ab6173 at 1/100 dilution overnight at +4°C. The secondary antibody (green) was DyLight® 488 donkey anti- sheep (ab96939) IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

References

This product has been referenced in:

  • Huang X  et al. Effects of electroacupuncture on luteal regression and steroidogenesis in ovarian hyperstimulation syndrome model rat. Life Sci 197:1-9 (2018). WB . Read more (PubMed: 29482802) »
  • Wang R  et al. Neuropeptide Y-Positive Neurons in the Dorsomedial Hypothalamus Are Involved in the Anorexic Effect of Angptl8. Front Mol Neurosci 11:451 (2018). Read more (PubMed: 30618603) »
See all 9 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

Application
Immunohistochemistry (Frozen sections)
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: r.t°C
Sample
Rat Tissue sections (Brain)
Specification
Brain
Permeabilization
Yes - 0.2% Triton X-100
Fixative
Paraformaldehyde

Dr. Fabio Canneva

Verified customer

Submitted Jul 10 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up